CAZyme Information: FOC4_g10008363-t38_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOC4_g10008363-t38_1-p1
• CAZy Family: GH35
• CAZyme Description: Beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375		44020.12	8.5335

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fodoratissimumrace4	14596	N/A	137	14459

• Gene Location: location=KB726324:269248-270375(+)

Full Sequence      

MVPRVVSRGILVIGICSLLWWTFRPLRGSHAVFTEPLQTIDLLSPTSDNGRKTPELYASR
AAHDFCSVHEYSAFIPKSPSSERKVYDMLMINDELDFLEIRLNALYDYVDYFIIVESAKT
FQANPKPLILKENWDRFRRYHDKIIYHELTFPSTFDPHRAWDYEDLQRDAPFDQVMLSLV
GPRAPNKGDVLIVADVDEIPRPQTLLVLRYCKFPRRLTLSSKFYYYSFQFLHTGPEWQHP
QATYYQGRRTLKPTNLRNGDGGFRPFRFLERGVLSNSGWHCSSCFPTIDQFLNKMASFSH
RWMNREEYRDKDKIAAAVREGKDLWGREQDQFVRIENNKDMPPLVLDEPKRFGYMISRDG
PSAGFVDYNGKEKRQ

Enzyme Prediction     

No EC number prediction in FOC4_g10008363-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT17	63	355	1.3e-79	0.9788732394366197

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398414	Glyco_transf_17	2.69e-50	54	326	48	300	Glycosyltransferase family 17. This family represents beta-1,4-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase (EC:2.4.1.144). This enzyme transfers the bisecting GlcNAc to the core mannose of complex N-glycans. The addition of this residue is regulated during development and has functional consequences for receptor signalling, cell adhesion, and tumor progression.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD58150.1|GT17	2.40e-279	1	375	1	375
CCT71044.1|GT17	1.51e-256	1	373	1	373
QGI83999.1|GT17	1.51e-256	1	373	1	373
QGI66762.1|GT17	1.51e-256	1	373	1	373
QGI97648.1|GT17	1.51e-256	1	373	1	373

PDB Hits     

FOC4_g10008363-t38_1-p1 has no PDB hit.

Swiss-Prot Hits     

FOC4_g10008363-t38_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.942958	0.057062

TMHMM  Annotations     

Start	End
5	23