CAZyme Information: FOC4_g10008245-t38_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOC4_g10008245-t38_1-p1
• CAZy Family: GH35
• CAZyme Description: Mannan polymerase II complex ANP1 subunit

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
529		59487.99	6.5595

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fodoratissimumrace4	14596	N/A	137	14459

• Gene Location: location=KB726989:1723942-1727907(+)

Full Sequence      

MMPRHHAAAFSNGYPRGNTFDISPHKFQPRTLTPAQRRRNKLLVRLCILAAILFVFSLWL
WPSSPVASLVSFGLLSAGGAPELETVRYYDLTTVQGTARGWEREERILLCVPLRDAEAHL
GMFFSHMRNLTYPHHLIDLAFLVSDSKDNTLKVLSESLEAIQADQDPKQPYGEISIIEKD
FGQKVNQDVESRHGFAAQASRRKLMAQARNWLLSAALRPYHSWVYWRDVDVETAPFTILE
DLMRHNKDVIVPNVWRPLPDWLGGEQPYDLNSWQESETALALADTLDEDAVIVEGYAEYA
TWRPHLAYLRDPFGDPDMEMEIDGVGGVSILAKAKGFRSGVHFPAFSFEKHAETEGFGKM
SKRMGYSVIGLPHYTIWHLYEPSVDDIRHMEEMERERLAREKQEEEKKKNQQKIKEEYSD
TRNEWEKDKQEMQNLAAQPKPVKDTQKAPSRDGLAQPHNQQPGSGNQAKAGSGNAAQGDI
KAQVVKREGNAARQEGKAVQEGDKRAAVGAQDAPKANPGAAQQAGNAAA

Enzyme Prediction     

No EC number prediction in FOC4_g10008245-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	84	347	1.7e-122	0.9888059701492538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	2.76e-159	85	347	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD59569.1|GT62	0.0	1	529	13	541
CCT73465.1|GT62	0.0	1	529	1	529
QGI99973.1|GT62	0.0	1	529	1	498
QGI86452.1|GT62	0.0	1	529	1	498
QGI69084.1|GT62	0.0	1	529	1	498

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	1.60e-61	86	383	6	304	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74745|ANP1_SCHPO	1.22e-164	17	401	11	394	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P32629|ANP1_YEAST	7.00e-161	85	390	61	366	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|P23642|VAN1_YEAST	2.77e-125	85	397	171	530	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|Q00314|VAN1_CANAX	6.88e-119	86	397	76	437	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P53697|MNN9_CANAL	3.25e-61	86	381	73	368	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999391	0.000616

TMHMM  Annotations     

Start	End
42	61