CAZyme Information: FOC4_g10006817-t38_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOC4_g10006817-t38_1-p1
• CAZy Family: PL3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
518	KB726988|CGC7	55411.70	7.3082

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fodoratissimumrace4	14596	N/A	137	14459

• Gene Location: location=KB726988:979245-981125(+)

Full Sequence      

MTEPRRSARPSPHRSSSALAPANTSDSTSIRPRNRRLASALDDDSDTATSREASRSRRGR
NLNVHDTAASPSPARSYGLLTAFSPANSRSASPLPSERGGAPHRTNSAANLTNFFNDSLT
QSWASIQGFTSSLLSGDNGAARRSQSHNRAGSRSGTWGRDFSGSGSMKKTGGAWGPAPPQ
EPNLNDVGAGSLAERETALKAARRAMVLESHDGVNGGLDVSGNHKRRNSDESTPEQPQTQ
EYLVYIHKVEPSDTYAGIILKYQCREDAFRKANGLWTRDSIQVRKWLTIPVDACDVRGRP
CDPPSWHNAHSVDLLAPTPAVEENSSAVHDDFFSRPINGTPSATQPSEEDKPWTHALRLV
ARAPSVTDPSFLAPLCQVRDEGIPSMSVMGSETAHFGFKSGESSSIVENPSGEGQEIGST
QQGNGLDKAAAAVETWLRGALSRKPSSQLDRIRGMPEGSRPERNGDLIELTDTGSDDGRP
SGAPPISLMESLQIKSSSRSEGEGGARGRMVAKGDKDD

Enzyme Prediction     

No EC number prediction in FOC4_g10006817-t38_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
212030	LysM	3.67e-04	246	289	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
396179	LysM	0.009	247	290	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD49082.1|CBM50	1.17e-313	1	518	1	626
QGI68044.1|CBM50	8.20e-300	1	518	1	626
QGI98929.1|CBM50	1.64e-292	1	518	1	626
QGI85273.1|CBM50	1.69e-292	1	518	1	579
QPC76417.1|CBM50	8.59e-262	6	518	4	627

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2DJP_A	5.69e-07	247	291	18	62	Chain A, Hypothetical protein SB145 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CY38|Y2072_EMENI	4.64e-28	117	355	115	353	Uncharacterized protein AN12072 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN12072 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOC4_g10006817-t38_1-p1.