CAZyme Information: FOC4_g10006370-t38_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOC4_g10006370-t38_1-p1
• CAZy Family: PL4
• CAZyme Description: Initiation-specific alpha-1,6-mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321	KB726995|CGC6	36850.62	6.3430

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fodoratissimumrace4	14596	N/A	137	14459

• Gene Location: location=KB726995:1290915-1292035(+)

Full Sequence      

MHSKQPHNILDAARIASKAALSKRERQMPFSNIPLLVHQTWKKTAADSWNPRILPWVELW
LEDSIYIDRGPSMAYLFWDDTGMRALVEEFENDFLERYDTLLTPVERSDVFRILVCKHFG
GIYGDLDTELIQHPATWISGSDMATWTDPKTGKAHGYYNTSVTPDYETPVVSLLWGLEAD
NDPESDAYWRQSYTYPQQLSQWAFAAAPQHPVFERYMDNLRNYTKDNEPTAQNSDPLKRT
GPAAVTLATKSWLEDHVGFRWASLTGLKDGGKSKLVHDILILPITGFQPRSEIMPSRHGI
VEAFQFRRGVWKGLSKTFWSL

Enzyme Prediction     

No EC number prediction in FOC4_g10006370-t38_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.21e-15	33	144	82	184	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.86e-09	71	142	16	91	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD59215.1|GT32	1.84e-222	1	288	1	288
CCT73207.1|GT32	7.44e-195	3	312	78	394
QPC63324.1|GT32	1.32e-171	4	289	81	366
CEF84399.1|GT32	2.18e-171	4	288	64	348
CZS74875.1|GT32	2.40e-168	4	288	64	348

PDB Hits     

FOC4_g10006370-t38_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	8.08e-20	25	312	133	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q10323|IMT3_SCHPO	5.97e-10	33	157	57	178	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P38287|CSH1_YEAST	1.62e-07	27	127	56	147	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	1.64e-07	33	127	55	140	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P31755|OCH1_YEAST	8.16e-07	33	220	96	282	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOC4_g10006370-t38_1-p1.