CAZyme Information: FOC4_g10006257-t38_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOC4_g10006257-t38_1-p1
• CAZy Family: GH2
• CAZyme Description: Choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
560	KB726995|CGC9	62305.03	6.2716

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fodoratissimumrace4	14596	N/A	137	14459

• Gene Location: location=KB726995:968241-972154(+)

Full Sequence      

MAVNNGAYFDFIVVGGGTAGNIVAARLAENPNARILVIEAGIGTSKDNEEIRTPGLAMDI
RGSKYDWAYKTTMIKRDDYERIEKPNTRGKALGGSSSLNYFSWVPGSKGTFDMWEEYGGK
EWTWEPLVPYLRKRGPIPIAHAELMPEMKPFRELLTKAWKSTGEPISENIFDGTMRGLVH
SVNTIYKGRRSGSFLAVADKPNITIFPEVHSKRLIIDQADRIAKGVTVITASGEELDLYA
TREVIVSQGVFETPKLLMLSGIGPKTELAKHNIPLLVDSPHVGQHLLDHPGVPFVLKIKD
SYSMDNHVLRKGALQDKVMSAYANGHAGPMGSPFLEMIGFPRIDSYLEKSPEYRAAKAAN
DGLDPFCPYGQPHFELDFIPLFGSAFQWHFPHPNKGSYMTVMVDLVRPVSEGGEVTLNSS
DPLQQANINLNYFNNDLDIIAMREGIRFSYDVLKNGEGFKDIVEDEYPWDMPLHDDEAMK
RTVLDRSQTSFHPCGTARLAKSIEEGVVNPSLQVHGIKNLRVIDASVIPVIPDCRIQNSV
YMVAEKGADAIKRDHADLYH

Enzyme Prediction     

No EC number prediction in FOC4_g10006257-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	9	554	4.6e-139	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.05e-78	9	556	8	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	8.82e-76	9	552	6	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	2.07e-38	408	546	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	5.50e-23	9	543	56	568	Protein HOTHEAD
366272	GMC_oxred_N	2.57e-20	88	290	23	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD59313.1|AA3_2	0.0	1	560	1	580
QGI68848.1|AA3_2	0.0	1	559	1	579
QGI99737.1|AA3_2	0.0	1	559	1	579
CCT73322.1|AA3_2	0.0	1	559	1	579
QGI86218.1|AA3_2	0.0	1	559	1	565

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	2.80e-300	5	559	3	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	8.02e-300	5	559	3	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	2.29e-299	5	559	3	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	2.33e-64	9	554	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	8.93e-64	7	554	1	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A9AMZ9|BETA_BURM1	2.28e-53	9	552	6	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) OX=395019 GN=betA PE=3 SV=1
sp|Q0R4L2|PDH3_LEUMG	2.94e-53	9	556	41	600	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|B1Z034|BETA_BURA4	3.15e-53	9	552	6	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia ambifaria (strain MC40-6) OX=398577 GN=betA PE=3 SV=1
sp|B0KN19|BETA_PSEPG	2.18e-52	9	552	5	534	Oxygen-dependent choline dehydrogenase OS=Pseudomonas putida (strain GB-1) OX=76869 GN=betA PE=3 SV=1
sp|A4JJG6|BETA_BURVG	2.21e-52	9	552	6	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) OX=269482 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000019	0.000013

TMHMM  Annotations     

There is no transmembrane helices in FOC4_g10006257-t38_1-p1.