CAZyme Information: FOC4_g10005918-t38_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOC4_g10005918-t38_1-p1
• CAZy Family: GH18
• CAZyme Description: Putative feruloyl esterase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
276		29236.83	9.1741

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fodoratissimumrace4	14596	N/A	137	14459

• Gene Location: location=KB726570:1490692-1491575(-)

Full Sequence      

MRSLLTLTLALFASAGLGDAASAGCGKQPPSSGVKTMQVNGKNREYTLQLPNNYQNNKPH
RLVFGYHWLSGNMGNVVQGGYYGLRNLAGDSTIFIAPNGLNAGWANQGGEDITFTDQMLA
FAKQNLCIDEKQVFATGFSYGGAMSHSVACSRPNDFAAVAVISGALLSGCNGGNTPVSYL
HIHGSADNVLSIQQGRQLRDKWIGTNGCQQKQVNDPAPGAQNYVKTSYTCSRKPVTWIGH
GGGHVADPTANGQKFAPGETWTFFNAAAGKSAKLRC

Enzyme Prediction     

No EC number prediction in FOC4_g10005918-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	39	211	2.7e-22	0.6167400881057269

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226040	LpqC	3.32e-20	15	267	18	297	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
224423	DAP2	8.11e-07	40	198	374	573	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
223477	YpfH	4.02e-06	119	200	87	170	Predicted esterase [General function prediction only].
223489	DLH	1.89e-04	119	187	100	169	Dienelactone hydrolase [Secondary metabolites biosynthesis, transport and catabolism].
395257	Peptidase_S9	2.18e-04	93	161	16	95	Prolyl oligopeptidase family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB80928.1|CBM1|CE0	2.06e-131	1	269	1	270
CDP29168.1|CBM1|CE0	5.96e-129	6	269	6	270
CAP62092.1|CBM1|CE0	5.96e-129	6	269	6	270
QBZ61744.1|CBM1|CE0	5.17e-124	1	269	1	271
CCA72326.1|CBM1|CE0	3.11e-111	1	267	1	269

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WYD_A	1.67e-06	41	198	18	176	C-terminal esterase domain of LC-Est1 [uncultured organism],3WYD_B C-terminal esterase domain of LC-Est1 [uncultured organism]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0XU32|FAEC_ASPFC	2.97e-84	7	267	11	272	Probable feruloyl esterase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=faeC PE=3 SV=1
sp|A4D9B6|FAEC_ASPFU	2.97e-84	7	267	11	272	Probable feruloyl esterase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=faeC PE=3 SV=1
sp|A1DI08|FAEC_NEOFI	5.96e-84	7	267	11	272	Probable feruloyl esterase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=faeC PE=3 SV=1
sp|A1CC33|FAEC2_ASPCL	3.16e-81	7	267	11	272	Probable feruloyl esterase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=faeC-2 PE=3 SV=1
sp|A2QYU7|FAEC_ASPNC	4.81e-80	9	267	11	270	Probable feruloyl esterase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=faeC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000209	0.999758	CS pos: 20-21. Pr: 0.9804

TMHMM  Annotations     

There is no transmembrane helices in FOC4_g10005918-t38_1-p1.