CAZyme Information: FOC4_g10005637-t38_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOC4_g10005637-t38_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320	KB726570|CGC6	34458.06	10.0745

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fodoratissimumrace4	14596	N/A	137	14459

• Gene Location: location=KB726570:790124-791086(+)

Full Sequence      

MAAKSLVVGGTGGIGYGIACRIAASSPSSTVIISGRNEPKNIPHSNIQFKQLDASSMRAI
KTYTDELKASQPALFEMLSPIWNALTLLTVLMATFISPAAALPNIRVLPLGDSITKGTGS
TGLVGYRLPLRQKILKQGVKVNMVGTLKNGNMVDGHHEGHSGKMLADINGYWQKPIQARP
NVVLIHAGTNNMDQGKDLDIAASILADIVDGIFKVAPDVTICLAPVIWANDKKMQANTDK
FNPQVRSLISARQKKRKHILEVPIDIKKEDLGDSKHPNDDGYDKMANAWLKAILEADKKG
WLKMPIKMSPEDAPGTGLGA

Enzyme Prediction     

No EC number prediction in FOC4_g10005637-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	105	293	6.3e-50	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	5.23e-48	105	293	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	1.13e-15	110	284	2	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	5.95e-12	107	292	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
239947	SGNH_hydrolase_YpmR_like	1.00e-08	110	292	5	204	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. This subfamily contains sequences similar to Bacillus YpmR.
238865	sialate_O-acetylesterase_like1	7.83e-08	105	293	1	187	sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61617.1|CE3	1.69e-141	73	299	532	758
CEI70576.1|CE3	4.53e-134	77	320	1	244
QPC62878.1|CE3	1.65e-133	99	320	20	241
CCT63634.1|CE3	4.40e-86	83	319	8	246
QPC79577.1|CE3	5.89e-86	83	319	8	246

PDB Hits     

FOC4_g10005637-t38_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RLB8|CESA_RUMFL	7.48e-10	99	303	38	265	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOC4_g10005637-t38_1-p1.