CAZyme Information: FOC4_g10005124-t38_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOC4_g10005124-t38_1-p1
• CAZy Family: GH134
• CAZyme Description: Pyranose 2-oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
552	KB726480|CGC5	61517.82	6.8041

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fodoratissimumrace4	14596	N/A	137	14459

• Gene Location: location=KB726480:732796-734803(+)

Full Sequence      

MVHKPTPSPSSASDAVRWEETDVLIVGSGPIGATFAHTLVKKGIKVTMIDIGQQETRRIG
DHKKNSVAVQKDISLFTNTVKGELHPLSVPTNTARPVMEPASWAPRDYAKVKRPTDSAYV
LNGQNPDQKSYGNLPAAAATRVVGGMGSHWTCCTPRQHKGIERSDLFSDGEWNTLYGRAE
KLFTKTDDAFDDSVRQKLVKRVLTEAYPDREMKSMPLACKRKHDNKEYVEWSCTATILGE
LSKPEYFYKGEERFFDMRPNTQCDKLELDPDGQIAWALINDLEANQQYYIHAKKYVVCAG
AVLTPGILHKSGLKPRLPALGHYLTEQPMAFCQVVLDRKLVNSVEGEDVVKAHRESHGND
PLPFPFNDPDPQVYFPLSEKYPWHTQIHRDAFGYGEVPSNIDQRLVVDLRWFGYMKPDQE
NYVTFSNKTKDQFGMPQPTFNFVLDEEADERCKRMITDMIEVARKLGGFLPGAEPKYLAP
GSALHICGTYRAGSTPADSVVNKNGKAWGVNDLVLGGCGVIPTQNACNPTLTAACFALAA
ADKIIEDLHVDQ

Enzyme Prediction     

EC	1.1.3.10:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	19	548	5.8e-231	0.9981785063752276

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274143	pyranose_ox	0.0	21	532	1	530	pyranose oxidase. Pyranose oxidase (also called glucose 2-oxidase) converts D-glucose and molecular oxygen to 2-dehydro-D-glucose and hydrogen peroxide. Peroxide production is believed to be important to the wood rot fungi in which this enzyme is found for lignin degradation.
398739	GMC_oxred_C	4.27e-15	417	532	1	135	GMC oxidoreductase. This domain found associated with pfam00732.
225186	BetA	7.47e-14	19	532	6	521	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	1.45e-05	259	328	146	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
223717	FixC	7.28e-05	19	63	2	42	Dehydrogenase (flavoprotein) [Energy production and conversion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62719.1|AA3_4	0.0	1	552	1	545
CCT76068.1|AA3_4	0.0	1	552	1	545
QGI70943.1|AA3_4	0.0	1	552	1	545
QGJ01833.1|AA3_4	0.0	1	552	1	545
QGI88281.1|AA3_4	0.0	1	552	1	545

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BG7_A	1.55e-124	22	544	48	609	Chain A, Pyranose oxidase [Trametes ochracea],3BG7_B Chain B, Pyranose oxidase [Trametes ochracea],3BG7_C Chain C, Pyranose oxidase [Trametes ochracea],3BG7_D Chain D, Pyranose oxidase [Trametes ochracea],3BG7_E Chain E, Pyranose oxidase [Trametes ochracea],3BG7_F Chain F, Pyranose oxidase [Trametes ochracea],3BG7_G Chain G, Pyranose oxidase [Trametes ochracea],3BG7_H Chain H, Pyranose oxidase [Trametes ochracea]
1TT0_A	2.19e-124	22	544	48	609	Crystal Structure of Pyranose 2-Oxidase [Trametes ochracea],1TT0_B Crystal Structure of Pyranose 2-Oxidase [Trametes ochracea],1TT0_C Crystal Structure of Pyranose 2-Oxidase [Trametes ochracea],1TT0_D Crystal Structure of Pyranose 2-Oxidase [Trametes ochracea],2IGK_A Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_B Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_C Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_D Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_E Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_F Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_G Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_H Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea]
3BLY_A	2.19e-124	22	544	48	609	Chain A, Pyranose oxidase [Trametes ochracea]
3BG6_A	2.19e-124	22	544	48	609	Chain A, Pyranose oxidase [Trametes ochracea],3BG6_B Chain B, Pyranose oxidase [Trametes ochracea],3BG6_C Chain C, Pyranose oxidase [Trametes ochracea],3BG6_D Chain D, Pyranose oxidase [Trametes ochracea],3BG6_E Chain E, Pyranose oxidase [Trametes ochracea],3BG6_F Chain F, Pyranose oxidase [Trametes ochracea],3BG6_G Chain G, Pyranose oxidase [Trametes ochracea],3BG6_H Chain H, Pyranose oxidase [Trametes ochracea]
4MOG_A	2.91e-124	22	544	48	609	Pyranose 2-oxidase V546C mutant with 3-fluorinated glucose [Trametes ochracea],4MOH_A Pyranose 2-oxidase V546C mutant with 2-fluorinated glucose [Trametes ochracea],4MOP_A Pyranose 2-oxidase V546C mutant with 3-fluorinated galactose [Trametes ochracea],4MOP_B Pyranose 2-oxidase V546C mutant with 3-fluorinated galactose [Trametes ochracea],4MOP_C Pyranose 2-oxidase V546C mutant with 3-fluorinated galactose [Trametes ochracea],4MOP_D Pyranose 2-oxidase V546C mutant with 3-fluorinated galactose [Trametes ochracea],4MOQ_A Pyranose 2-oxidase V546C mutant with 2-fluorinated galactose [Trametes ochracea],4MOQ_B Pyranose 2-oxidase V546C mutant with 2-fluorinated galactose [Trametes ochracea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B2E9|P2OX_EMENI	4.23e-145	16	544	18	574	Pyranose 2-oxidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=p2ox PE=3 SV=2
sp|Q75ZP8|P2OX_LYOSH	2.29e-134	22	548	37	603	Pyranose 2-oxidase OS=Lyophyllum shimeji OX=47721 GN=p2ox PE=2 SV=1
sp|Q8J2V8|P2OX_TRIMT	1.57e-123	10	550	23	563	Pyranose 2-oxidase OS=Tricholoma matsutake OX=40145 GN=p2ox PE=1 SV=1
sp|Q6UG02|P2OX_PHLGI	4.33e-123	5	544	32	607	Pyranose 2-oxidase OS=Phlebiopsis gigantea OX=82310 GN=p2ox PE=1 SV=1
sp|Q8J136|P2OX_PENSG	6.29e-123	22	544	48	609	Pyranose 2-oxidase OS=Peniophora sp. (strain SG) OX=204723 GN=p2ox PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000026	0.000032

TMHMM  Annotations     

There is no transmembrane helices in FOC4_g10005124-t38_1-p1.