CAZyme Information: FOC4_g10005009-t38_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOC4_g10005009-t38_1-p1
• CAZy Family: GH13
• CAZyme Description: Cutinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
187	KB726480|CGC4	20061.94	9.8950

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fodoratissimumrace4	14596	N/A	137	14459

• Gene Location: location=KB726480:449418-450099(-)

Full Sequence      

MIYARGSRQAGNVGKANNTGPALFNSLADRIGLENLAVQGVTYKARRRDYIFKGGCNEGS
KTMAKLINQAASQCPDTKIVIAGYSQGAQLLHKAAKNVTAGVTQHIAAAVTLGHPEQPMG
KIAASRSLSVCRPGDSFCDKTIPWKPFVPFVGAPLWWFITMLDTHGDYNENATAVANWIA
DRVTNIG

Enzyme Prediction     

No EC number prediction in FOC4_g10005009-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	1	182	7.4e-34	0.9576719576719577

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	7.17e-39	1	139	7	146	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62814.1|CE5	2.40e-131	1	187	76	262
CEI39834.1|CE5	2.98e-47	1	183	81	251
CEF84782.1|CE5	3.36e-45	1	182	81	246
CZS73725.1|CE5	3.36e-45	1	182	81	246
QPC64283.1|CE5	2.73e-44	1	182	81	246

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	1.21e-22	1	139	84	220	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
1FFD_A	4.03e-15	1	142	36	182	Chain A, CUTINASE [Fusarium vanettenii]
1CUW_A	4.03e-15	1	142	36	182	Chain A, CUTINASE [Fusarium vanettenii],1CUW_B Chain B, CUTINASE [Fusarium vanettenii]
1XZG_A	4.03e-15	1	142	36	182	Chain A, CUTINASE [Fusarium vanettenii]
1CUF_A	5.61e-15	1	142	36	182	Chain A, CUTINASE [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8X1P1|CUTI_BLUHO	7.19e-36	1	183	71	236	Cutinase OS=Blumeria hordei OX=2867405 GN=CUT1 PE=3 SV=1
sp|G4MZV6|CUTI2_MAGO7	4.30e-29	1	183	45	214	Cutinase CUT2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=CUT2 PE=1 SV=1
sp|Q00298|CUTI_BOTFU	9.28e-25	1	139	36	173	Cutinase OS=Botryotinia fuckeliana OX=40559 GN=cutA PE=1 SV=1
sp|Q8TGB8|CUTI_MONFR	2.75e-23	1	139	36	172	Cutinase OS=Monilinia fructicola OX=38448 GN=CUT1 PE=2 SV=1
sp|Q9Y7G8|CUTI_PYRBR	3.11e-22	1	139	37	174	Cutinase pbc1 OS=Pyrenopeziza brassicae OX=76659 GN=pbc1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOC4_g10005009-t38_1-p1.