CAZyme Information: FOC4_g10004934-t38_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOC4_g10004934-t38_1-p1
• CAZy Family: GH128
• CAZyme Description: Beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
868	KB726480|CGC1	97170.92	5.1335

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fodoratissimumrace4	14596	N/A	137	14459

• Gene Location: location=KB726480:262912-265723(+)

Full Sequence      

MTLVKAQPPLNNGHVKNEAKEWAQDKLSQMTLEEKVLLLTGEDLWRTNAVPRLGISRIKT
SDGPVGVRGGIFTDGVSAASAPTGVSLAATWDLSVIRDVCSVLIHEAKSKEVDVLLGPTV
CIPRTPLGGRNFEAYSEDPYLTGKIAAKFINCLQDAGIGACIKHLAANDQENRRFFIDEK
IPDRALREIALQPFQIAIRDSNPWTVMTAYNKINGTFCSAHEFLIQDVLRKEWGWDGLVM
SDWFGTNSIVPSVKAGLDLEMPGPVRRRGKHLIDAYQKSLVDLSYIDASASRVLELVHRV
GKSNIPDWKEGDEKADDLPEHRAIFRRAGAEGIVLLKNSAKLLPLSNLDGKIVAILGPNA
LRSVATGGGSSNLAPHYRTTPYQSIKSEIAAKFPTANVHAHAGILTHRYIPLVDQDVMTN
PETGKPGFQLSLFRNMNHSGQPFMVEHRPSSNLVCYDGLPPELTTGERYSYRGRTILKPK
TTGLHEFSLSSCGPGKLMLDGEVIIDIERHWWSPKSSLFMSYGSPEERVKLYMEAEREYE
LLLESISREPKPYDLDYMAELEREEVQDGGRIGFMENPGDLDKFFHDGVDMARDSDIAIV
VVGKDHEWETETSDMVSMDLPGRSNEFISSVAAVNPNTIVVNQTGSPITMPWEDEVSAIV
QAWYQGQEQGNCLADVLLGTVNPSGKLPITFPKRIEDTPPYDNYPGENDVVYYGEGIYAG
YRFYDHRKIEPLFPFGAGLSYTTFEYSNMRISSNDFYEEVGIEVEVDVTNTGSRDGKEIV
QFYVGQIDPRLHRPERELKGWEKVFVPAGQTVTARMKIDKVSLSYWDDRFDKWVIEKDAE
YRVTAAKDSRDEGLTVTFRSPKEYRWVN

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	49	262	5.2e-60	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	4.91e-73	25	851	40	756	beta-glucosidase BglX.
224389	BglX	5.04e-69	42	391	47	389	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	5.32e-50	577	741	73	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	6.12e-39	23	819	53	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	9.25e-38	52	296	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62879.1|GH3	0.0	1	868	1	868
CCT75821.1|GH3	0.0	1	868	1	887
QGJ01965.1|GH3	0.0	1	868	1	887
QGI71072.1|GH3	0.0	1	868	1	887
UPK89362.1|GH3	0.0	1	868	1	872

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.28e-167	27	866	10	842	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.03e-162	27	866	10	842	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	7.90e-136	27	859	9	667	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	4.79e-106	21	866	2	719	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	6.94e-105	21	866	2	719	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	7.42e-202	27	851	15	829	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P27034|BGLS_RHIRD	5.40e-188	25	864	4	814	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|A1DNN8|BGLJ_NEOFI	2.18e-187	27	837	18	833	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	2.88e-187	27	867	10	837	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	3.20e-186	27	867	10	837	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999909	0.000132

TMHMM  Annotations     

There is no transmembrane helices in FOC4_g10004934-t38_1-p1.