CAZyme Information: FOC4_g10004267-t38_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOC4_g10004267-t38_1-p1
• CAZy Family: PL1
• CAZyme Description: Lectin-B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352		35593.50	4.4515

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fodoratissimumrace4	14596	N/A	137	14459

• Gene Location: location=KB726264:478802-480104(+)

Full Sequence      

MELSLLYFLCILSIASASFPFNFGLSSSPVLLPRAKNPTSKDGNCGSNSETNATCLTSTF
GNCCSEKGFCGKTSSYCDEGCQAAFGSCSSGADGQLVSTSGSCGATSTSNVTCEGSTYGD
CCSEKGYCGKNATYCGAGCQSMFGTCSSSDESSTTTATSDKTSTSTAASATSLGAISIDG
NCGSNSDIDATCKDSTFGDCCSAKGYCGGTSDYCGSGCQSDFGSCDSSSSSASSSASSST
SSAESSSTTPSTTPSTSSLSTGAKAGIAVGSVIGGLGAIGLVAWLVLRRKNRKSSQQLTD
SDVGKPNEETRYELHDERTHEMHAQNLVELPADYGRVDDRAAAGYDGAYRGH

Enzyme Prediction     

EC	-	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
211316	ChtBD1_1	1.19e-08	186	226	4	44	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
211316	ChtBD1_1	2.52e-07	49	88	4	43	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
211316	ChtBD1_1	1.14e-06	107	144	4	41	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
395135	Chitin_bind_1	9.55e-05	198	220	14	36	Chitin recognition protein.
395135	Chitin_bind_1	0.001	44	83	1	36	Chitin recognition protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI78660.1|CBM18	2.75e-162	1	352	1	352
QGI61474.1|CBM18	2.75e-162	1	352	1	352
CCT65321.1|CBM18	2.75e-162	1	352	1	352
QGI92372.1|CBM18	2.75e-162	1	352	1	352
QKD51953.1|CBM18	1.83e-160	1	352	1	352

PDB Hits     

FOC4_g10004267-t38_1-p1 has no PDB hit.

Swiss-Prot Hits     

FOC4_g10004267-t38_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000332	0.999647	CS pos: 17-18. Pr: 0.9630

TMHMM  Annotations     

Start	End
5	27
265	287