CAZyme Information: FOC4_g10004021-t38_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOC4_g10004021-t38_1-p1
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
528	KB726281|CGC6	56103.76	7.6291

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fodoratissimumrace4	14596	N/A	137	14459

• Gene Location: location=KB726281:755371-757038(-)

Full Sequence      

MLLSLILSVLAAHTGLALGDTSVTVNINKRLQVIDGFGVSEAYGHAKQFQNLGPGPQKEG
LDLLFNTTTGAGLSIIRNKIGCDDSNSITSTNTDNPAKQPVFHFDGDDDGQSAKSMGRLC
GTPGVSCTSGDWRHRYVEMIAQYLSYYKEAGIPVSHVGFLNEGDGSDFMLSSAEQAADVI
PLLHSALNSKGLGDIKMTCCDNIGWKSQMEYTAKLAELGVESYLSVITSHEYSSSPDQSM
NTTLPTWMSEGAANDQAFATAWYVNGGSNEGFTWAVKIAQGIVNADLSAYIYWEGVETNN
RGSLSHVIDTDGTKFTISSILWAIAHWSRHIRPGAHRLSTSGVVQDTIVGAFENVDGSVV
LVLTNTGTAAQTVDLGVTGRTFSTAQAFTSHAEAQMVNTKVTLSDNRVKVTVPVHAVVTV
KLTTARSSNAISAAISSQSTPTPANDGHSLVRQKPSSTTLSIVRAPTSAQTTSVVESAKA
VKYPVPAVTPKSSKKSPAKKNSHQSHSAHGAAHHRCGHGNHRRGRCTK

Enzyme Prediction     

No EC number prediction in FOC4_g10004021-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	113	420	5.3e-109	0.7020316027088036

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227807	XynC	5.54e-13	23	419	36	425	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
396577	Glyco_hydro_59	1.56e-05	54	329	20	293	Glycosyl hydrolase family 59.
407314	Glyco_hydro_30C	8.56e-05	334	384	1	52	Glycosyl hydrolase family 30 beta sandwich domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62186.1|GH30_7	0.0	1	528	1	555
CCT73001.1|GH30_7	3.22e-302	1	528	1	560
QGI99497.1|GH30_7	1.86e-301	1	528	1	560
QGI85808.1|GH30_7	7.54e-301	1	528	1	560
QGI68607.1|GH30_7	4.14e-298	1	528	1	560

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6M5Z_A	3.50e-84	17	424	20	455	Chain A, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
7O0E_A	7.58e-73	21	367	3	388	Chain A, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	1.25e-71	21	367	10	395	Chain AAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
6IUJ_A	1.41e-65	9	378	6	426	Chain A, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612],6IUJ_B Chain B, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612]
6KRL_A	2.00e-63	20	378	92	497	Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris [Saccharomyces uvarum],6KRN_A Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris in complex with aldotriuronic acid [Saccharomyces uvarum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2Q1N4|XY30A_MYCTT	9.80e-73	21	367	27	412	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000212	0.999759	CS pos: 19-20. Pr: 0.8788

TMHMM  Annotations     

There is no transmembrane helices in FOC4_g10004021-t38_1-p1.