CAZyme Information: FOC4_g10003988-t38_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOC4_g10003988-t38_1-p1
• CAZy Family: CE5
• CAZyme Description: 6-hydroxy-D-nicotine oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1233	KB726281|CGC6	135089.63	6.3121

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fodoratissimumrace4	14596	N/A	137	14459

• Gene Location: location=KB726281:666560-670261(+)

Full Sequence      

MAWHAQLALVLGLVCLASARCTGMSDDCSSNPIPLRQFNPLNFHATTCNLKWNNGCTRNK
NGQLQQKPPPFLLCSSGQFPSGLIPVDAYTLAMQTRGAGSTQQSAKYTLHGLWPSSAGGN
GARDQPYGCLNGEEFDEGILKTFGDLLSYFWPTDPKFGNTMQCFILSEWMKHGTCAVIPG
ADGNAFRLSQEAYFRTAFVLANEFNANAALRQQLDEPGSEDLESNVSTGCVQCAYLATVD
WEGTDVQSVPRMSGDCVNQCFACGDSWDICPPAQLNSTVELDPSNAPVDTSDGGTNSDGL
ANFAVLDFAMPAFISNNTSPWEGTWRSFGAEQGGSGKFQFAQTFTDKVLTVTTDSPYPQT
CSYERLGPKELVLRCGGNRLEECLVQRLPDIGGLEAAFLACNHTGQPAPASFYTAMDTPG
CGNFLMFRCKASAEGCSFSPDATSAASKSKTKTNSGSDSEPSLVSHSQPGIAGAPTKLLG
LWRSLQVSSHYEEGLANWSFTSDGQASVKWPNHPERGVERYSVSHSREDPSRVLLATASG
AITTCRFKFQYQPVYSYAVLDCTAGDKKVQWAMGRCNPCSAECRYSCSAENDNCGAGSCD
PSESSSAGALPSPQGDSDHRWCTPEDSSCWPTKTAIDKLEKALDPTVPRLGVQWSNYPAP
QPAPVPTGSINNQAFYGLGSKGLKALYYYEDIAEMQRPCFNIKDGVNIWNTASDMCKAAL
HQNEYRNWNPFIVVFPLNQRHITAALKFAAQHRLCIATAGTGHEYNSRNSCPTGGILIRT
ILLKNKEFLPTWNEDPALAPAGAFRFGAGSIFAEMHAFSAKYDRVVASGWCSTVGMTGYH
LGGGHGPFAPSMGLGVDNVLEIEVLQVGRNIHGQTVVHKKIVSRRKNPQLFWAMRGGGGG
VWGVILSMTLRAHAVPDGGLSRVFMSQTGTFCPGSQNKFGYEWLREMWPRFAEWQLRLNS
KVSTQPGFFIDTSKYKKGDLCTATWTFNFEYFYAGGQKEQDYVMFRDSLKDVLQTKTVQE
DNFSSAYDYLLSMPPNKFQITVMNPLPAPHEPSDDATGSQNSVFVSREDMETKFASTMMD
VLDICVNSLKTPDKTSPDPMGYRCGFHYLYTSITGNLGSAQPGDTAISPGFRSGLMLWNA
RTLSTKQCEDTIYKLGSNSYFSESSYVMHNWTDRYWSEKKYKQLLAVKRAHDPGNLFWCH
HCVGDDPDDAYGNPLGVKKAQDVKVDSYKKDEL

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	720	917	1.1e-39	0.39082969432314413

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238220	RNase_T2	2.45e-14	87	219	2	129	Ribonuclease T2 (RNase T2) is a widespread family of secreted RNases found in every organism examined thus far. This family includes RNase Rh, RNase MC1, RNase LE, and self-incompatibility RNases (S-RNases). Plant T2 RNases are expressed during leaf senescence in order to scavenge phosphate from ribonucleotides. They are also expressed in response to wounding or pathogen invasion. S-RNases are thought to prevent self-fertilization by acting as selective cytotoxins of "self" pollen.
396238	FAD_binding_4	2.90e-13	730	865	1	129	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
238512	RNase_T2_euk	1.17e-11	108	213	31	124	Ribonuclease T2 (RNase T2) is a widespread family of secreted RNases found in every organism examined thus far. This family includes RNase Rh, RNase MC1, RNase LE, and self-incompatibility RNases (S-RNases). Plant T2 RNases are expressed during leaf senescence in order to scavenge phosphate from ribonucleotides. They are also expressed in response to wounding or pathogen invasion. S-RNases are thought to prevent self-fertilization by acting as selective cytotoxins of "self" pollen. Generally, RNases have two distinct binding sites: the primary site (B1 site) and the subsite (B2 site), for nucleotides located at the 5'- and 3'- terminal ends of the sessil bond, respectively. This CD includes the eukaryotic RNase T2 family members.
395357	Ribonuclease_T2	3.07e-11	108	212	32	124	Ribonuclease T2 family.
223354	GlcD	1.67e-08	702	864	2	159	FAD/FMN-containing dehydrogenase [Energy production and conversion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57322.1|GH43_11	4.51e-18	730	916	598	775
QKD57322.1|CBM91|GH43_11	4.51e-18	730	916	598	775
UNI23960.1|AA7	3.35e-10	730	955	48	244
UQC87672.1|AA7	2.51e-09	699	917	39	239
EGX49222.1|AA7|CBM1	3.03e-09	728	917	162	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F72_A	6.02e-22	730	1206	124	561	Crystal structure of VAO-type flavoprotein MtVAO615 at pH 7.5 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_A Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_B Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6FYE_A	2.77e-12	705	915	20	211	The crystal structure of EncM H138T mutant [Streptomyces maritimus],6FYE_B The crystal structure of EncM H138T mutant [Streptomyces maritimus]
6EO5_A	3.86e-12	713	973	31	262	Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens],6EO5_B Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens]
6EO4_A	3.86e-12	713	973	31	262	Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens],6EO4_B Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens]
6FYD_A	6.41e-12	705	915	20	211	The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_B The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_C The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_D The crystal structure of EncM T139V mutant [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A0E0RTV6|ZEB1_GIBZE	2.33e-22	622	913	29	291	FAD-linked oxidoreductase ZEB1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ZEB1 PE=2 SV=2
sp|L0E2Q5|PHQH_PENFE	4.96e-22	742	947	131	328	FAD-linked oxidoreductase phqH OS=Penicillium fellutanum OX=70095 GN=phqH PE=3 SV=1
sp|G2QDQ9|VAO15_MYCTT	3.10e-21	730	1206	124	561	VAO-type flavoprotein oxidase VAO615 OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=MYCTH_2305637 PE=1 SV=1
sp|L0E159|MALF_MALAU	3.35e-21	740	914	132	302	FAD-linked oxidoreductase malF OS=Malbranchea aurantiaca OX=78605 GN=malF PE=1 SV=1
sp|A0A7L8UYL4|FFSJ_ASPFV	8.58e-21	742	926	135	310	FAD-linked oxidoreductase ffsJ OS=Aspergillus flavipes OX=41900 GN=ffsJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000199	0.999777	CS pos: 19-20. Pr: 0.9810

TMHMM  Annotations     

There is no transmembrane helices in FOC4_g10003988-t38_1-p1.