CAZyme Information: FOC4_g10003106-t38_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOC4_g10003106-t38_1-p1
• CAZy Family: CBM38|GH32
• CAZyme Description: Cell wall synthesis protein psu1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
439		46428.68	5.4602

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fodoratissimumrace4	14596	N/A	137	14459

• Gene Location: location=KB726987:451711-453085(+)

Full Sequence      

MKNLITYTLAATLAAGATAQHHQHQHMHARRHAGSKVEKRDPDVITEYVVAATETVYELG
GEEIDIHAAKAGLDGGSLVIVGESNPTYDAPKAPATSAAQPAKVSQPKKEVGAQFYESKT
AAATTAVPKPVYSAPAATQSKASKPKSSKPKTSGSSSSYSGSSGATGVDKTFESGTIDCS
EFPSEYGAVALDWLNLGGWSGIQYCPDFSFASKLIYQIDTAISGDGCKPGAMCSYACPVG
YQKTQWPAAQGSERESIGGLYCNKDGKLELTRDGYDTLCEPGVGGVTIQNDLDEQVVTCR
TDYPGTENMVVPAVAEPGSNVAVCNPNQDKYYVWDGVGTSAQYYVNKKGYTVEEACVWDS
SKGKDAGNWAPVVLGVGMKNGMTFVSIFQNSPTSTALLDFNIEIKGGNKKCSYVNGQWSE
GTGCTTAAAEGQKITVRYY

Enzyme Prediction     

EC	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	137	438	8.1e-99	0.9702970297029703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	4.64e-131	174	425	1	244	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD47956.1|GH132	6.78e-304	1	439	1	439
QGI75597.1|GH132	4.78e-287	1	439	1	435
CCT61952.1|GH132	4.78e-287	1	439	1	435
QGI89290.1|GH132	4.78e-287	1	439	1	435
QGI58379.1|GH132	4.78e-287	1	439	1	435

PDB Hits     

FOC4_g10003106-t38_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WGL5|SUN1_ASPFU	1.90e-89	163	438	137	414	Secreted beta-glucosidase sun1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=sun1 PE=1 SV=1
sp|D4AM57|SUN41_ARTBC	5.13e-79	163	439	169	448	Probable secreted beta-glucosidase ARB_04747 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04747 PE=1 SV=1
sp|Q9UR09|PSU1_SCHPO	6.81e-70	172	438	162	417	Probable secreted beta-glucosidase PSU1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psu1 PE=3 SV=1
sp|P53616|SUN4_YEAST	1.04e-69	166	438	157	419	Probable secreted beta-glucosidase SUN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUN4 PE=1 SV=1
sp|B3LRC2|UTH1_YEAS1	8.98e-69	172	438	106	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=UTH1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000775	0.999201	CS pos: 19-20. Pr: 0.9663

TMHMM  Annotations     

There is no transmembrane helices in FOC4_g10003106-t38_1-p1.