CAZyme Information: FOC4_g10002567-t38_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOC4_g10002567-t38_1-p1
• CAZy Family: AA9
• CAZyme Description: Glucan 1,3-beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303	KB726213|CGC2	33667.56	9.9126

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fodoratissimumrace4	14596	N/A	137	14459

• Gene Location: location=KB726213:13694-14705(-)

Full Sequence      

MKLFGSIGALAAALMLLPGQALAGQYKGFSMGANRADGLCKYTADWKKDFQTIKSWNKGF
NAVRLYSADDCNTLVKAVPAAKQTGMKILVGVWATDDAHFGRDKAALLKVIKQYGTDWIA
AISVGSEDLYRKDISPDKLAQQIYDVRGMVRQFNKNLKVGHTDTWTAWVDGRNDVVTKAC
DIAITTNGFPYWQGVPIKDALRLKTFQNSYWNVQKHVKAVNSKAAVWVGETGWPTKGPNY
QKAAATTASLQSYYNNVGCWLWQQKDASGFWFTAFDAPLATPEVEKYFGIANKDRKLKFS
LTC

Enzyme Prediction     

No EC number prediction in FOC4_g10002567-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	49	303	9.1e-32	0.9421221864951769

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	3.11e-59	18	295	37	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.51e-16	28	303	2	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61100.1|GH17	1.15e-226	1	303	1	302
CCT74252.1|GH17	4.30e-222	1	303	1	302
QGI87033.1|GH17	4.30e-222	1	303	1	302
QGJ00576.1|GH17	4.30e-222	1	303	1	302
QGI69688.1|GH17	4.30e-222	1	303	1	302

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	7.92e-30	26	302	37	293	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	5.80e-29	26	302	37	293	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13990|BGL2_SCHPO	7.44e-63	29	303	44	318	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4
sp|P15703|BGL2_YEAST	1.77e-48	1	303	1	310	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|D4B2W4|BGL2_ARTBC	1.00e-41	9	303	6	301	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1
sp|Q4WG16|EGLC_ASPFU	4.61e-41	11	303	8	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	4.94e-41	11	303	8	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000225	0.999747	CS pos: 23-24. Pr: 0.9752

TMHMM  Annotations     

There is no transmembrane helices in FOC4_g10002567-t38_1-p1.