CAZyme Information: FOC4_g10001702-t38_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOC4_g10001702-t38_1-p1
• CAZy Family: AA7
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
424		47329.41	7.1463

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fodoratissimumrace4	14596	N/A	137	14459

• Gene Location: location=KB726276:72380-73746(-)

Full Sequence      

MKPLSYLSTALAFASPLWATQIHPRGASDWPNGPFSTDGRWVVDASGQQVRFAGVNWPGA
AEVMIPEGLQYRSVEQIVSQIKSVGFNAVRLTYAIEMVDQIYSNNGKDISIETAFVNGLG
AENGTLALAKVLENNPSFTNETTRLQVFDAIAEKLATQNIHILLDNHISKGKWCCSSTDG
NTWWGDSQFNVANWLRGLTFMANHGKQWSGLVAMSLRNELRNVENNSALLKTYNWQTWYK
YVQQGAKAINKANGDVLVYLSGLGYDTWITPVFTQTALTPGKEVFDKAAFAGFSDKLVLE
IHNYEKTVGSCATLKSHLYTKGFQGMNSTDAATKAVFPVQLTEWGHLMDATTWQGVYSTC
LRSYVGSLKASWFMWVIAGSYYTRYGKPDNDELWGLLNHNWTDWRNPDFVKSGLTPFIRQ
TLDS

Enzyme Prediction     

EC	3.2.1.164:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	42	378	1.2e-148	0.9970326409495549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	6.21e-05	43	375	1	266	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD50536.1|GH5_16	5.02e-312	1	422	1	422
AEO68439.1|GH5_16	2.93e-179	1	422	1	425
UQC87314.1|GH5_16	1.31e-177	1	418	1	418
AEO58520.1|GH5_16	3.07e-168	28	422	25	421
QBZ60790.1|GH5_16	4.51e-168	1	422	1	422

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1VRX_A	1.21e-13	33	422	4	354	Chain A, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus],1VRX_B Chain B, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus]
1ECE_A	2.17e-13	33	422	4	354	Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus],1ECE_B Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus]
4TUF_A	9.09e-08	40	263	7	198	Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913],4TUF_B Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913],4TUF_C Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913],4TUF_D Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C0HLA0|GH5FP_CHAOB	8.58e-54	34	410	30	388	Glycosyl hydrolase 5 family protein OS=Chamaecyparis obtusa OX=13415 PE=1 SV=1
sp|P23548|GUN_PAEPO	5.45e-15	33	407	37	373	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P54583|GUN1_ACIC1	2.90e-13	24	422	36	395	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P19487|GUNA_XANCP	3.68e-07	7	263	12	223	Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=engXCA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000885	0.999105	CS pos: 19-20. Pr: 0.9592

TMHMM  Annotations     

There is no transmembrane helices in FOC4_g10001702-t38_1-p1.