CAZyme Information: FOC4_g10001454-t38_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOC4_g10001454-t38_1-p1
• CAZy Family: AA4
• CAZyme Description: Beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
685	KB726282|CGC1	75552.39	5.1303

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fodoratissimumrace4	14596	N/A	137	14459

• Gene Location: location=KB726282:244255-246517(+)

Full Sequence      

MNDSNTPSTPDTEYSPPCSPQQKIQHLRDTRSAAREKLARLTLVSLLTAADFWRTKAIPE
KGIPSIKTTDGPNGARGGIFVGGTKAALFPCGISLAATWNKDLLYQVGQHLALEVRARSA
EMLLAPTVCMHRHPLGGRNFESFSEDPFLTGKLAAQYIKGLQDRGVAATIKHFVGNEQET
NRLTIDSLITERPLREIYLKPFEIAVREANPWAVMTSYNLINGVHADLNKHTLKDILRGE
WGYEGTVVSDWGGINSSIESVEAGCDIEFPYSSKWRLDKLVTAVNEGRISIEDINQAAEN
VLTLVERLKGGDMSPEAPEREDDREETRELIRIAGHEGLTLLKNDGGILPLCPKSTKVAV
IGPNANRHIAGGGGSASLNPYYNTIPLDSIRKVSKQKVSFAQGCHIHKWLPVASEYCTEQ
SGKPGVHIDWYAGDKFEGNPVVKQRRTNTDLFLWDSAPLSEVGPEWSAVATTYLMPRTTG
KHTISFMSVGPGKLFINDKLVLDLWDWTEEGEAMFDGSIDYLVDVDMEADKAVELRVEMT
NELRPISKQKQFGITHKYGGCRIGYKEQDQVDYIQQAVQTARDADVAVVIVGVDAEWESE
GYDRQTLDLPADGNQDRLIEAVVKANPKTVVINQSGSPVHMPWVDRVPVILQGWYQGQEA
GNALADVLFGIENPSGKLPVSDLDP

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	57	269	5.1e-71	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.03e-78	51	376	48	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	5.56e-52	62	304	65	316	Glycosyl hydrolase family 3 N terminal domain.
185053	PRK15098	2.58e-51	89	681	120	598	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	2.84e-51	339	681	1	188	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	1.14e-38	42	681	55	587	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI92108.1|GH3	0.0	1	679	1	679
QGI61209.1|GH3	0.0	1	679	1	679
QGI78386.1|GH3	0.0	1	679	1	679
QKD53598.1|GH3	0.0	1	679	1	679
CCT64887.1|GH3	0.0	1	679	1	679

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.79e-143	44	681	19	669	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.83e-139	44	681	19	669	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.57e-89	46	678	20	496	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	5.20e-80	45	678	19	494	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	2.86e-74	55	681	43	546	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	1.59e-181	38	681	15	660	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|A1DNN8|BGLJ_NEOFI	2.74e-162	44	681	27	679	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|Q4WLY1|BGLJ_ASPFU	1.74e-160	44	681	27	680	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2
sp|B0Y8M8|BGLJ_ASPFC	6.85e-160	44	681	27	680	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2
sp|P27034|BGLS_RHIRD	2.29e-151	44	679	15	636	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999168	0.000820

TMHMM  Annotations     

There is no transmembrane helices in FOC4_g10001454-t38_1-p1.