CAZyme Information: FOC4_g10000746-t38_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOC4_g10000746-t38_1-p1
• CAZy Family: AA11
• CAZyme Description: Putative acetylxylan esterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363	KB726182|CGC2	39836.80	5.0814

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fodoratissimumrace4	14596	N/A	137	14459

• Gene Location: location=KB726182:23831-26477(+)

Full Sequence      

MKLTAFISLWLLTLCYTALAAEVVPRSTFTEVTDYGDNPTGTRMWLYVPKTLAPKPAVVV
GIHWCTGSAQAYYQGTRWAFYAETYGYIVIYPQTPYTQDKCWDVASKMTLTHDGGGASNS
IANMAKFVIKEYSADSSRVFVTGTSSGAMMTNVMAAAYPDIFAAGIAYAGGIAYAGVPAG
CFRSEDDIPDYWNSTCATGQSIYTQGQWANVVKNMYPGYNGPRPKMQIYHGSVDEVLNVQ
NYYETIKQWTGVFGYPAEPESTTANVPRSPYTRYVFGDKLQTFLGQGITHNIDVFPEEDL
KWFGFTDPVTPSPTITATVPTNTGGSEGSPQWGQCGGMGWTGPKQCATPYSCVKINDWYS
QCQ

Enzyme Prediction     

EC	3.1.1.72:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	42	241	5.1e-22	0.7709251101321586

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	2.27e-37	44	264	1	209	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	5.52e-23	7	274	12	255	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	1.89e-21	46	184	5	138	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
197593	fCBD	6.60e-14	330	363	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	2.65e-12	331	359	1	29	Fungal cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62233.1|CBM1|CE1	2.68e-270	1	363	1	357
UQC81390.1|CBM1|CE1	7.55e-196	1	357	1	369
CEI67776.1|CE1	8.53e-172	1	281	1	275
CEF87325.1|CE1	1.69e-158	1	313	1	307
CZS85651.1|CE1	1.69e-158	1	313	1	307

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	1.90e-106	31	305	6	274	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]
6RV8_A	3.86e-08	329	362	5	38	Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor covalent complex with the aldouronic acid UXXR [Cerrena unicolor],6RV8_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor covalent complex with the aldouronic acid UXXR [Cerrena unicolor]
6Q8M_A	1.06e-07	332	362	375	405	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
4BMF_A	4.90e-06	332	362	7	37	Chain A, ENDOGLUCANASE EG-1 [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WBW4|AXE1_ASPFU	4.73e-127	21	362	26	370	Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=axeA PE=3 SV=1
sp|A1DBP9|AXE1_NEOFI	2.81e-125	15	362	12	367	Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=axeA PE=3 SV=1
sp|B8NBI2|AXE1_ASPFN	8.82e-122	22	307	27	307	Probable acetylxylan esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=axeA PE=3 SV=1
sp|A9JPE6|AXE1_ASPFL	7.16e-121	22	307	27	307	Probable acetylxylan esterase A OS=Aspergillus flavus OX=5059 GN=axeA PE=3 SV=1
sp|Q75P26|AXE1_ASPOR	7.16e-121	22	307	27	307	Acetylxylan esterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=axeA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000241	0.999731	CS pos: 20-21. Pr: 0.9820

TMHMM  Annotations     

There is no transmembrane helices in FOC4_g10000746-t38_1-p1.