CAZyme Information: FOC4_g10000321-t38_1-p1

Basic Information

• Species: Fusarium odoratissimum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium odoratissimum
• CAZyme ID: FOC4_g10000321-t38_1-p1
• CAZy Family: AA1
• CAZyme Description: Alcohol dehydrogenase [acceptor]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
599		64047.58	8.0517

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fodoratissimumrace4	14596	N/A	137	14459

• Gene Location: location=KB726241:27850-29978(+)

Full Sequence      

MPKLQALILAALSCLHATTASAYPRQDVNLRTEYDYIIVGAGASGLTVANRLSEDPAVTV
LVIEAGDFDKNEDIVTIPGLAGNAVGTKYDWNLTYPSTTSLNGRSISIPLGKVVGGSTKL
NADYDRWAELGNGDWQWKTLLPYFKKNEKFTGPTAGIKKEYGITTDPSAHGSSGYIHSSY
SPFFWPTTKNLVEATGELDINIAVDQANGGAIGGYFCPHNLNRETLVRSSAQDYYSAVSQ
RRNLQLLPGHQVTRVLTSKNGSSVRANGVEFAKNRDSAKKTLKAKKEVILAAGAVHTPQI
LQVSGIGDSALLSSIDVPVVVDLPAVGQNFHDHVFLAVVSTIDAPIQGSNLTKNATFAAE
ARAEYDQQKKGPLTSPTADFLLFLPLSNYTSAASDIHKQATGQDGSKFLPTGTPAEVVKG
YKKQQKVLNEKLLDTRSAILEIIWADGTSVLGLQHPYSRGSVKAKSSNIFDSPEANPEFL
KNPLDLAVLAEGVKFARKLSGAPSIKALNPFELVPGANVTSDSDLEQFIRSSASTLFHPA
GSCKLGSRSEGGVVDEKLRVYGVKGLRIVDASVIPLLPATHTMTTVYAVAEKVSCIQAC

Enzyme Prediction     

No EC number prediction in FOC4_g10000321-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	33	594	2.8e-176	0.9859154929577465

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.14e-102	27	593	1	529	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	6.88e-94	33	594	5	528	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.42e-43	456	592	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	8.70e-29	97	333	10	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	6.63e-25	20	586	37	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKC01502.1|AA3_2	0.0	1	592	1	601
QKD60653.1|AA3_2	0.0	1	592	1	601
QGJ00970.1|AA3_2	0.0	1	592	1	601
CCT74664.1|AA3_2	0.0	1	592	1	601
QGI70079.1|AA3_2	0.0	1	592	1	601

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	6.71e-101	29	594	1	579	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	7.97e-88	13	592	10	633	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
5OC1_A	5.89e-75	33	592	1	556	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	3.21e-74	33	592	2	557	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	1.97e-73	7	594	13	594	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5GMY3|GMCH_MALSM	6.46e-104	6	591	13	609	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	6.46e-104	6	591	13	609	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5AUN2|XPTC_EMENI	1.76e-91	16	592	24	608	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	3.43e-78	1	592	1	624	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q0R4L2|PDH3_LEUMG	1.65e-76	26	594	33	592	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000518	0.999447	CS pos: 22-23. Pr: 0.9603

TMHMM  Annotations     

There is no transmembrane helices in FOC4_g10000321-t38_1-p1.