CAZyme Information: FOC1_g10015825-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10015825-t38_1-p1
• CAZy Family: GT4
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
515		59272.44	8.0761

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB731261:1487813-1489360(-)

Full Sequence      

MWSGLRVPHFLGGTRPRSPTPTPTVDDPQQRNHLLGDWTDIEQNRIMKEGDERQNEDEEL
DQDLGPTKKTRRRVRFADFEKPTTQRRSWIRTRTRRCSCLRSPSSAILFAALLLCLGVGY
VYRWKVETALHRSWIPDAASERFSQNPLPPPPEHLQITNYTLPLRTRGRDIVDVNGRRFK
LASVNWYGASDEFFVAGGLDIQHRDDIAKTIKKLGFNSVRLPYADELVIKNPVVEEKHLR
ANPDLVGLRALDIFHIIVQTLTKSGIAVIVNNHITSATWCCGADPCDAGWSNDHLGPICR
VRQTEDEWIQHWETIMLPHINNPLVIGVDLRNEIRGLWGTMPWSKWAPAAERCGNRLLQM
NRDWLVIVEGTESSNDLSKVCKRPILLDVTHRLVYSAHVYAWSGWGSWEGRFLQRDYDSF
AKTMHHNWGYIVDKQIAPVWVGEIGAPVQPSVGDANYWQHLVRFLQEKDSDFGYWALNAR
KPKGNATERYGLLQDDWKTPVLDYRMKDMLELMSA

Enzyme Prediction     

No EC number prediction in FOC1_g10015825-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	171	485	2.4e-167	0.9968253968253968

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	2.12e-23	205	479	27	270	Cellulase (glycosyl hydrolase family 5).
225344	BglC	6.78e-14	204	504	75	383	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD47435.1|GH5_24	0.0	1	515	1	515
CCT62409.1|GH5_24	0.0	25	515	2	492
QGI76084.1|GH5_24	0.0	25	515	2	492
QGI58869.1|GH5_24	0.0	25	515	2	492
QGI89779.1|GH5_24	0.0	25	515	2	492

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1VRX_A	8.54e-42	166	499	8	338	Chain A, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus],1VRX_B Chain B, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus]
1ECE_A	2.27e-41	166	499	8	338	Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus],1ECE_B Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus]
3VVG_A	1.84e-24	181	499	30	363	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
2ZUM_A	3.29e-24	181	515	63	411	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3AXX_A	3.29e-24	181	515	63	411	Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_B Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_C Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23548|GUN_PAEPO	4.04e-44	166	499	41	369	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P54583|GUN1_ACIC1	3.82e-39	166	499	49	379	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|C0HLA0|GH5FP_CHAOB	6.29e-30	159	509	26	394	Glycosyl hydrolase 5 family protein OS=Chamaecyparis obtusa OX=13415 PE=1 SV=1
sp|P50400|GUND_CELFI	2.82e-23	164	499	46	400	Endoglucanase D OS=Cellulomonas fimi OX=1708 GN=cenD PE=3 SV=1
sp|P10474|GUNB_CALSA	4.71e-22	164	499	630	984	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000082	0.000000

TMHMM  Annotations     

Start	End
100	122