CAZyme Information: FOC1_g10015099-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10015099-t38_1-p1
• CAZy Family: GT31
• CAZyme Description: Putative glucan endo-1,6-beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
430		48900.49	6.3136

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB731260:1330157-1331495(-)

Full Sequence      

MHYSTLLPLILAGFASAWLPHERDLAAFNQTARHEQLGKRFKPNLPSGVTKIRGVNFGGW
LVCEPWMQRDEWANVLKCGDSVSEFDCMRDHYLGSNRETGNNRFEQHWKNWINPATVQSV
HDVGLNTIRIPIGYWSYTDIVDKASEPFADGNRMLPYLDAVVQKAADLGIYVIIDLHGAP
GGQQEDVFTGQNNKPAGFFNDYNFGRAQKWLAWMTNRIHTNSAYSTVGVIEVLNEPVSRH
DANNRYPAPGEDPGLIQKYYPAALKAVRDTEASLKVPDNKKLHVQFMSSKWDSGNPRSVS
SVANDPYTAFDDHNYIGFALGNDNGDQYKLMHSACTDSRLVSGQDFTFTGEWSMTSNADW
HDKNFFNKFFTAQQQLYEKPGMAGWIYWTWKTETNDPRWTYSYATYLNYIPTDAAGLEKN
VYQDVCAGYR

Enzyme Prediction     

EC	3.2.1.75:9

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	98	401	2.2e-118	0.9866666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	2.27e-20	98	411	56	382	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	3.11e-11	107	390	15	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD56404.1|GH5_15	0.0	1	430	1	430
CCT70427.1|GH5_15	0.0	1	430	1	430
QGI66295.1|GH5_15	0.0	1	430	1	430
QGI97179.1|GH5_15	0.0	1	430	1	430
QGI83539.1|GH5_15	0.0	1	430	1	430

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3O6A_A	5.09e-24	52	411	14	384	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1EQP_A	8.91e-24	52	411	9	379	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	3.05e-23	52	411	9	379	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PF0_A	3.25e-23	52	411	15	385	Chain A, Hypothetical protein XOG1 [Candida albicans]
2PB1_A	3.25e-23	52	411	15	385	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DGM6|EXGB_NEOFI	8.32e-88	11	417	11	393	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgB PE=3 SV=1
sp|Q5B6Q3|EXGB_EMENI	3.41e-86	15	413	14	399	Glucan endo-1,6-beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgB PE=2 SV=1
sp|B0XRX9|EXGB_ASPFC	1.30e-85	11	401	11	377	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgB PE=3 SV=1
sp|Q4X1N4|EXGB_ASPFU	1.45e-84	11	401	11	377	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgB PE=3 SV=1
sp|Q0C8Z0|EXGB_ASPTN	8.10e-83	6	413	9	393	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000349	0.999633	CS pos: 17-18. Pr: 0.9750

TMHMM  Annotations     

There is no transmembrane helices in FOC1_g10015099-t38_1-p1.