CAZyme Information: FOC1_g10014818-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10014818-t38_1-p1
• CAZy Family: GT2|GT2
• CAZyme Description: Periplasmic beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
772		84492.02	5.4953

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB731260:420155-422710(+)

Full Sequence      

MKLSGYLCVAVLAVAGQAAKDKPVYKDPKASIDDRVEDLLKRMTIQDKAAQLIQGDMTNY
LNLTDETVNKTGLAWNFKYRANSIWTGLYANMTTIKKAAKLGQDYLAKETELGKCIPAFV
QSEGLHGVLILNGTIFNSPIGMGCSFNPELIEKMADVIATESRAVGINQLFSPQVDLARE
LRFGRVEECFSEDPYLAGEMGYRYVKGLQAGGVSAMVKHYAAFATPEQGINTGPVHGGER
ELRSLYLPPFKRAIIDGGATSIMSSYNSYDGVPVVSDSHLLTDILREEWGYKYYVISDAG
GTARLAQAFYVCPLEDDECITLETLPAGNDAEMGGGYWSFEIIPELVKAGKLDEKVVDTA
VSRVLRSKFEMGLFEKPFTGVADDKIWDYVNTKAHKKVARQLDAESIVLLENHENILPLK
KDANVAVIGPMAHGYVNYGDYVIHTAMTRGVTPYDGIKAASKGKVTFTQGCERWSTDESG
FKEAVAAAEAADVAVVVVGTWTRDQNELWGGLNATTGEHIDASNLNLIGAMPKLVKAIIE
TGKPTVVVYSSGKPITEPWISEEASALIQQFYQSQEGGHALADILYGDVNPSGKLSVSFP
YDVGTTPIYYDHLNSARAWPNPGKIYENGTLKFGSNYVLENPEALYTFGYGLSYSKFDFS
KISVSKKNVTATDTVTVSVDVSNKSKRDGSEVVQLYVKDMLASVDVARYQLKGFKKVAVK
AGKTQTVKIDLKVEDWGLWNRKMKYVVEPGDFTVFVGNSSENFKGNATVTVS

Enzyme Prediction     

EC	3.2.1.120:1	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	115	333	2.3e-62	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.15e-156	1	764	1	758	beta-glucosidase BglX.
224389	BglX	2.63e-82	43	433	1	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	2.52e-60	77	758	49	770	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	2.40e-57	44	366	1	315	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	6.97e-46	407	654	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD56125.1|GH3	0.0	1	772	1	772
CCT70172.1|GH3	0.0	1	772	1	772
QGI96909.1|GH3	0.0	1	772	1	778
QGI83266.1|GH3	0.0	1	772	1	778
QGI66027.1|GH3	0.0	1	772	1	778

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	0.0	21	771	3	756	Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	0.0	21	771	3	756	Chain A, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	1.14e-119	11	764	25	778	Chain A, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5TF0_A	2.11e-117	33	764	10	744	Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5XXL_A	2.56e-112	26	764	5	745	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KMH0|PLH24_FORAG	4.25e-120	88	761	40	711	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|Q56078|BGLX_SALTY	2.51e-119	33	764	35	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	2.51e-119	33	764	35	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|T2KMH9|PLH34_FORAG	2.81e-100	25	764	29	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
sp|P14002|BGLB_ACET2	3.39e-93	116	771	37	674	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000343	0.999634	CS pos: 18-19. Pr: 0.9764

TMHMM  Annotations     

There is no transmembrane helices in FOC1_g10014818-t38_1-p1.