CAZyme Information: FOC1_g10014807-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10014807-t38_1-p1
• CAZy Family: GT22
• CAZyme Description: Putative lipoprotein ybbD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
915		99574.51	6.9755

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB731260:389197-392471(-)

Full Sequence      

MAPPPAGSTSSSSSREGYRSVNASHRYLKHAGPSRDEPEPQQKRSKYHVTRHRRRPTIMA
HTDNSDLDPAWQDLDRAIGQILIMGWDGTEVTPQIRSLIEDHHLGSIILTAKNLKSAQQT
AELVQELQTIAKNAGHLQPLLIALDQENGGVNSLFDEDYVCQFPSAMGVAATGRADLAYE
VTKATATEISACGVNLMLGPVLDVLNNARYQPLGVRATGDDPQEVSQYGLAALRGIRDAG
IASCGKHFPSYGNLNFLGSNLDVPIITQTLEELSISALVPFRNAVASGKLDAMFIGGCGI
SNPSMNVSHACLSDQVVDELLRDELGFNGVAISECLEMEALSHELGVQNGVIMAVEAGCD
LVLLCRAYDVQLEAIKGLKLASMHPGEELLLLTPLVKPLPASSLTKKLLAAKDSQNQAEG
QHEMWAHNGRDRSAILSGEGVFREFGKSLARARNEKLLHTSYTANGVRPDLVHENLIHRA
SCIIIVTADANRNLYQAGFTKHVDMMCSMLRTRGQKKQLIVVAVSSPYDFAMDKSIGTYL
CTFDFTENALHALARTLVGEIAPLGTLPGTLRKSKKVLKSRQHWLVEEYSAKRDASALND
LLRAVHRASAPDLQFLRTTTAASFQLNNANIAESHFVVRNSSTNALYGFAATYFVHGVGI
LGGVFVEPTKRDVSIGRSLHRRALRSLMQRRGIKQVQIGSAFPGVFLGIPNDVEVNTIKE
WFANSGWDVQFPRRVSNMILREVASWSAPEGLSQSIQRAGISFDLIHDLDNADGVLSHVR
NNANPEVLELYRHALSDSKLSGIVRAKDATGTLLGTIIVCKQRSPLETHIPSLVSRSEDI
GGIIAPVVPPGPQTTLVLQGLTLMGIRQARSHKATKVVLGCVVDDTESLTAMGFETLQEF
EEITNSPENVIIPHF

Enzyme Prediction     

No EC number prediction in FOC1_g10014807-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	139	363	4.8e-48	0.9490740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.38e-62	78	383	7	298	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	1.99e-52	74	381	2	302	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	8.29e-35	88	385	10	307	beta-hexosaminidase; Provisional
178629	PLN03080	4.58e-04	163	361	114	328	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD56115.1|GH3	0.0	1	909	1	980
QGI66013.1|GH3	0.0	1	914	1	986
CCT70761.1|GH3	0.0	1	909	1	981
QGI83252.1|GH3	0.0	1	914	1	982
QGI96895.1|GH3	0.0	1	914	1	975

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	4.24e-79	73	819	8	769	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	4.98e-59	74	571	13	531	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	5.87e-35	74	364	44	348	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	8.36e-35	74	364	18	322	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.09e-34	74	364	48	352	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	3.02e-34	74	364	44	348	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q3SKU2|NAGZ_THIDA	3.48e-34	82	435	6	347	Beta-hexosaminidase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=nagZ PE=3 SV=1
sp|B4SRK3|NAGZ_STRM5	9.00e-32	81	377	1	292	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain R551-3) OX=391008 GN=nagZ PE=3 SV=1
sp|B2FPW9|NAGZ_STRMK	1.65e-31	81	377	1	292	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=nagZ PE=3 SV=1
sp|C4LEY6|NAGZ_TOLAT	6.12e-30	82	390	4	302	Beta-hexosaminidase OS=Tolumonas auensis (strain DSM 9187 / TA4) OX=595494 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000068	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOC1_g10014807-t38_1-p1.