CAZyme Information: FOC1_g10014517-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10014517-t38_1-p1
• CAZy Family: GT2
• CAZyme Description: Cellobiose dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
505		54487.59	7.0288

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB730248:1487142-1488732(+)

Full Sequence      

MKFATIIGSALLGFASAGNTTTRKTTYDYIVAGAGASGLIVAERLANAGHKVLLVERGGP
SFYSTGNRDDLMKWNKTVTAYDVPGMAYYTDISPTIQWCTDIAASAGCLLGGSTMLNALM
FVKPRAADFESWPRGWQWEDGVSDAAKSVFERMPGSILPSADGKRYDDGAFEVMSKFLES
NGWDEVNALENVEAKDKIFTHPPWLISNGLRGGPVRDILPAAQALDNFSLQLHAKVIRAV
RKGPIITGIEVEHDDGSREIIKLSKGGSVVLSSGTHSTPRILFNSGIGPKKQIRIVQSGS
TNVKLPPASQWIDLPVGQRLKDHPIVVVDFQTKNKLQALPREAFTEPNDETVELFAEGSG
LLSQSAQRLNFWKSVEGNDGVTRYVQGTVNAPENNTISAKVYLTHGLTSHGTLEITPGGN
TNITQKPFLNTEGDRDALKTFVAELLSYARKPGSVLSVPSNVTADTILEVSYSGNHHLGS
ANMGAKNDGKSVXXXXXXXXXXXXA

Enzyme Prediction     

No EC number prediction in FOC1_g10014517-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	16	492	9.5e-171	0.9014598540145985

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	4.12e-30	20	374	1	354	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	1.02e-22	28	492	2	442	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
366272	GMC_oxred_N	9.18e-15	106	325	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
235000	PRK02106	5.86e-14	26	323	5	299	choline dehydrogenase; Validated
215420	PLN02785	3.56e-09	9	294	38	307	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD50085.1|AA3_1	0.0	1	492	1	492
BAE79276.1|AA3_1	0.0	1	492	1	492
QGI80203.1|AA3_1	0.0	1	492	1	492
QGI63034.1|AA3_1	0.0	1	492	1	492
QGI93920.1|AA3_1	0.0	1	492	1	492

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI7_A	1.41e-81	26	491	229	714	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
1KDG_A	1.51e-78	21	485	2	489	Chain A, cellobiose dehydrogenase [Phanerodontia chrysosporium],1KDG_B Chain B, cellobiose dehydrogenase [Phanerodontia chrysosporium]
1NAA_A	7.25e-78	25	485	1	484	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]
4QI4_A	1.18e-75	26	490	7	492	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI6_A	8.03e-74	26	490	229	714	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01738|CDH_PHACH	8.71e-76	21	485	229	716	Cellobiose dehydrogenase OS=Phanerodontia chrysosporium OX=2822231 GN=CDH-1 PE=1 SV=1
sp|Q3JLL7|BETA_BURP1	7.48e-20	21	361	2	338	Oxygen-dependent choline dehydrogenase OS=Burkholderia pseudomallei (strain 1710b) OX=320372 GN=betA PE=3 SV=1
sp|Q62CH8|BETA_BURMA	7.48e-20	21	361	2	338	Oxygen-dependent choline dehydrogenase OS=Burkholderia mallei (strain ATCC 23344) OX=243160 GN=betA PE=3 SV=1
sp|Q63KK7|BETA_BURPS	7.48e-20	21	361	2	338	Oxygen-dependent choline dehydrogenase OS=Burkholderia pseudomallei (strain K96243) OX=272560 GN=betA PE=3 SV=1
sp|B2JS89|BETA_PARP8	1.34e-18	27	361	6	338	Oxygen-dependent choline dehydrogenase OS=Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815) OX=391038 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001464	0.998497	CS pos: 17-18. Pr: 0.9617

TMHMM  Annotations     

There is no transmembrane helices in FOC1_g10014517-t38_1-p1.