CAZyme Information: FOC1_g10012576-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10012576-t38_1-p1
• CAZy Family: GT1
• CAZyme Description: Glucan endo-1,6-beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322	KB730192|CGC2	37170.56	5.6096

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB730192:1121977-1123134(+)

Full Sequence      

MNKGQDIADKNFQAHWKRWINQTDLDEMLSYGLNTIRVPLGYWLKEDLVDNSEHFPKGGL
EYLTQLCGWASDRGFYIILDLHGAPGAQEPNQPFTGQYAPTVGFYSDYNYGRAIEWLEWM
TDIIHTKKEYRNVGMLGLVNEPLNWDKAVDSLRKTYYPKACSAIRKVEDKLKVTSNNRLH
IHMMGSLWGSGKPTGFLRDTSFTAFDDHRYLKWDTSVEASHDAYIKKSCSDDRNTDGPTI
VGEWSLAVPDDVEKTDAWNPQTQKEFYTKWFSSQVHAYEENTLGWVFWTWKASLGDDYRW
SYRDAARAGVIPKDLDSLPSVC

Enzyme Prediction     

No EC number prediction in FOC1_g10012576-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	4	303	5.6e-149	0.9966666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	2.06e-17	2	322	56	394	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	2.06e-08	19	292	24	270	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK93324.1|GH5_15	4.76e-219	1	322	93	414
QKD58348.1|GH5_15	2.23e-207	28	322	1	277
UQC77665.1|GH5_15	5.68e-157	1	320	97	420
CCT71223.1|GH5_15	1.19e-156	10	303	83	324
QGI66947.1|GH5_15	1.19e-156	10	303	83	324

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	4.12e-23	4	322	53	391	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
3O6A_A	1.11e-22	4	322	58	396	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1CZ1_A	1.45e-22	4	322	53	391	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	1.54e-22	4	322	59	397	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PBO_A	1.54e-22	4	322	59	397	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B6Q3|EXGB_EMENI	2.02e-146	1	318	87	403	Glucan endo-1,6-beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgB PE=2 SV=1
sp|Q0C8Z0|EXGB_ASPTN	9.19e-144	4	317	84	396	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgB PE=3 SV=1
sp|A1DGM6|EXGB_NEOFI	9.26e-143	4	318	81	393	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgB PE=3 SV=1
sp|B0XRX9|EXGB_ASPFC	5.88e-133	4	303	81	378	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgB PE=3 SV=1
sp|Q2TZQ9|EXGB_ASPOR	1.16e-132	1	318	79	395	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOC1_g10012576-t38_1-p1.