CAZyme Information: FOC1_g10012060-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10012060-t38_1-p1
• CAZy Family: GH78
• CAZyme Description: Putative pectate lyase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413		43767.61	4.9492

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB730216:944551-945990(+)

Full Sequence      

MKFSLMLALTASSVAQAAQLAFPGAEGFGRYAVGGRQGEVYKVTNLNDSGTGSLRDAVSK
PNRIVVFDVGGVIKISERIVVSKNIYIAGQTAPGGGIVVYGNGWSLSNANDSIVRYITIR
MGKGGTSGKDAIGIADGKNIIFDHVSVSWGRDETFSINGDVTNVTIQNTIIAQGLVSHSC
GGLMQTDGGVSLFRNLYIDNKTRNPKVKGVNDFQNNVVYNWGGGGGYIAGDSQADSYANI
INNYFISGPDTTVTAFTRGNSFFHAYVKDNFYDSNRNGKLDGAALCEKASCYSDIDFVKT
PYNYPAPTALTPQAAVELVLKGVGNSLHRDTVDTALIDQVKSYGTKGGQISDEKEFGGVG
EIENGAALKDSDGDGIPDEWETKNGLNPNDASDGMKVASNGYANLENYVNSLV

Enzyme Prediction     

No EC number prediction in FOC1_g10012060-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	70	245	1.7e-52	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	2.22e-06	68	249	1	190	Amb_all domain.
226384	PelB	2.06e-05	3	277	13	305	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	2.40e-04	79	219	30	190	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.
408654	TSP3_bac	0.001	370	391	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD53272.1|PL1_2	7.81e-299	1	413	1	413
CCT64558.1|PL1_2	5.89e-294	1	413	1	413
QGI78072.1|PL1_2	1.43e-286	1	413	1	408
QGI60885.1|PL1_2	1.43e-286	1	413	1	408
QGI91786.1|PL1_2	1.43e-286	1	413	1	408

PDB Hits     

FOC1_g10012060-t38_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0XMA2|PLYC_ASPFC	3.70e-190	5	413	7	415	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
sp|A1DPF0|PLYC_NEOFI	5.25e-190	5	413	7	415	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1
sp|Q4WL88|PLYC_ASPFU	7.45e-190	5	413	7	415	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
sp|B8NQQ7|PLYC_ASPFN	5.54e-187	18	413	19	414	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
sp|Q2UB83|PLYC_ASPOR	2.12e-184	18	413	19	414	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000361	0.999614	CS pos: 17-18. Pr: 0.9762

TMHMM  Annotations     

There is no transmembrane helices in FOC1_g10012060-t38_1-p1.