CAZyme Information: FOC1_g10009131-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10009131-t38_1-p1
• CAZy Family: PL3
• CAZyme Description: Autolysin

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
485	KB731255|CGC2	52403.67	8.2684

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB731255:266970-268478(-)

Full Sequence      

MPIAPGTIQNCASWYDNDGSLPCELIPYAWNLSLEDLIKWNPSITAECGNFKEGFSYCIE
EKEAPVPISSTTTKFTTAPPSSTTLVPSKTTPTKPSTTAVGGNGVETPDPIQPGMVSNCN
KFYFVKQGDNCNAVSSKHGITLARFTTWNPKVGTGCSGLWADVWVCVSVIGHTATPTQST
KPTNGIETPSPIQAGMTKSCNKFHLIKSTTTCNSIQDYYKLPLKDFYSWNPAVGTNCQSL
LVDYWVCVSVVGWTAPTPTTPSNGIATPTPIQTGMAKNCNKFHTIKSTTTCASIQDYYKI
SFADFYAWNPAIGSMCTSLLVGYNVCVGVIGQTPSPTSTGNGITTPTPIQAGMTKSCNKF
HPVKSTTTCASIQDYYKISFADFYAWNPAIGSKCTALWVDYNVCVGVVGQKPTPTQPSNG
VTTPSPIQSGITKNCKKFHQVKSTTTCASIQNYYKITMANLFKWNPAIGSTCKSLWVDYW
VCVQA

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
180536	PRK06347	4.55e-07	99	387	307	576	1,4-beta-N-acetylmuramoylhydrolase.
212030	LysM	1.47e-06	121	165	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	7.86e-05	437	481	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	1.78e-04	281	325	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
180536	PRK06347	8.55e-04	215	465	344	576	1,4-beta-N-acetylmuramoylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD52295.1|CBM50	2.44e-267	1	485	32	409
CZS82988.1|CBM50	9.04e-201	1	485	35	523
UPK92405.1|CBM50	8.17e-173	2	483	34	505
QGI87027.1|CBM50	8.31e-169	2	483	181	659
QGI69682.1|CBM50	1.82e-168	2	483	206	684

PDB Hits     

FOC1_g10009131-t38_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALG0|LYSM1_ARTBC	3.20e-109	2	408	36	458	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4B4P8|LYSM2_ARTBC	1.95e-17	284	416	34	190	LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03438 PE=3 SV=1
sp|D4AZ68|LYSM3_ARTBC	6.26e-13	108	250	256	408	LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01488 PE=3 SV=1
sp|D4B5F9|PGDA_ARTBC	2.11e-10	272	329	380	437	Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03699 PE=1 SV=2
sp|D4AVW3|LYSM5_ARTBC	2.65e-10	2	169	360	536	LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00327 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOC1_g10009131-t38_1-p1.