CAZyme Information: FOC1_g10008940-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10008940-t38_1-p1
• CAZy Family: GT90
• CAZyme Description: Glucan 1,3-beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
291		32262.97	9.9501

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB730083:446832-447759(+)

Full Sequence      

MKLFGSIGAVAAALMLLPGQALAGQYKGFSMGANRADGLCKYTADWKKDFQTIKSWNKGF
NAVRLYSADDCNTLVKAVPAAKQTGMKILVGVWATDDAHFGRDKAALLKVIKQYGTDWIA
AISVGSEDLYRKDISPDKLAQQIYDVRGMVRQFNKNLKVGHTDTWTAWVDGRNDVVTKAC
DIAITNGLLRLKTFQNSYWNVQKHVKAVNSKAAVWVGETGWPTKGPNYQKAAATTASLQS
YYNNVGCWLWQQKDASGFWFTAFDAPLATPEVEKYFGIANKDRKLKFSLTC

Enzyme Prediction     

No EC number prediction in FOC1_g10008940-t38_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	3.13e-55	18	283	37	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	2.23e-15	28	291	2	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61100.1|GH17	2.24e-214	1	291	1	302
CCT74252.1|GH17	1.24e-211	1	291	1	302
QGI87033.1|GH17	1.24e-211	1	291	1	302
QGJ00576.1|GH17	1.24e-211	1	291	1	302
QGI69688.1|GH17	1.24e-211	1	291	1	302

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.69e-24	26	290	37	293	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.20e-23	26	290	37	293	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13990|BGL2_SCHPO	2.46e-57	29	291	44	318	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4
sp|P15703|BGL2_YEAST	8.92e-45	1	291	1	310	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|Q4WG16|EGLC_ASPFU	6.67e-39	10	291	7	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	7.12e-39	10	291	7	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|P43070|BGL2_CANAX	4.84e-38	29	291	24	305	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000231	0.999728	CS pos: 23-24. Pr: 0.9750

TMHMM  Annotations     

There is no transmembrane helices in FOC1_g10008940-t38_1-p1.