CAZyme Information: FOC1_g10008924-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10008924-t38_1-p1
• CAZy Family: GH43|CBM91
• CAZyme Description: Mitomycin radical oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
493		54104.89	5.2998

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB730083:411817-413443(+)

Full Sequence      

MKFDSLLAAASVGRGFAQASGTSTCVKAVITSPSSAFKDAQLEYWNGPQRNTAPACFFQP
TSENQVQAAIKEVTKVQCPFSIKGSGHSSNFDGSSIEGGFQFDLINIAHHDIISDGISVK
IGPGNRWGPLFSFLEEHGLTVAGGRDSGVGASGFIFGGGISFLAAQRGWGVDQLTSTNLV
LANGTLITVDSTSHPDLHKALQGGGAQNFGIVTSMTLNAFQFGGMWGGIKVTTADNFEHV
FNAYDRFARKVPEDEKAHMFMDFARVNGTLIVAQYMYYAEPVKNPMIFDDFRPIPAVIDT
LRLANHSEFAKEMEQITDTRGKRNLYWTRAFSFDIELLKSIYGLWVKISDSYADRLTAAL
DAQFIYPKMRKDSSAGSLFGLDDSDDVLQLIVLSIIWEDEADDEEAVKIVQELDAEIDIL
VKVRGKHCEFKYMNYGHNAQDIITGYGQKSKAFLKRVASQYDPDGVFQKLRLGGFKIDNN
ADNTLGHGSHDEL

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	44	266	1.5e-47	0.4847161572052402

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	3.48e-20	54	190	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	4.49e-17	45	467	23	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
273751	FAD_lactone_ox	2.12e-05	54	217	15	176	sugar 1,4-lactone oxidases. This model represents a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesizing ascorbic acid or a derivative. These include L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by Prosite motif PS00862; OX2_COVAL_FAD; 1.
178402	PLN02805	3.10e-04	39	217	113	302	D-lactate dehydrogenase [cytochrome]
223882	MurB	0.002	57	160	24	114	UDP-N-acetylenolpyruvoylglucosamine reductase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO20529.1|AA7	5.87e-16	54	217	90	253
CDR44461.1|AA7	3.26e-15	54	345	70	376
EGX49222.1|AA7|CBM1	3.89e-15	54	220	164	331
ANF89368.1|AA7	5.41e-15	54	220	61	228
AEO58513.1|AA7|1.1.3.-	5.41e-15	54	220	61	228

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EO4_A	3.13e-17	34	262	30	260	Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens],6EO4_B Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens]
6EO5_A	3.13e-17	34	262	30	260	Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens],6EO5_B Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens]
6FYD_A	3.91e-17	33	254	25	243	The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_B The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_C The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_D The crystal structure of EncM T139V mutant [Streptomyces maritimus]
6FYG_A	6.96e-17	33	254	25	243	The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_B The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_C The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_D The crystal structure of EncM V135T mutant [Streptomyces maritimus]
6FYF_A	6.96e-17	33	254	25	243	The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_B The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_C The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_D The crystal structure of EncM V135M mutant [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|M2T7Z1|TPCD_COCH5	1.52e-66	44	477	69	517	FAD-dependent monooxygenase tpcD OS=Cochliobolus heterostrophus (strain C5 / ATCC 48332 / race O) OX=701091 GN=tpcD PE=1 SV=1
sp|C8VPE5|SDCF_EMENI	1.14e-60	30	478	20	477	FAD-dependent monooxygenase sdcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=sdcF PE=1 SV=1
sp|A0A0U5GQ05|DRTC_ASPCI	8.83e-57	55	477	82	513	FAD-dependent monooxygenase drtC OS=Aspergillus calidoustus OX=454130 GN=drtC PE=1 SV=1
sp|B6H064|PRX3_PENRW	5.89e-42	34	479	48	509	FAD-dependent monooxygenase prx3 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=prx3 PE=2 SV=1
sp|D7UQ40|SOL5_ALTSO	8.51e-42	54	477	95	514	Bifunctional solanapyrone synthase OS=Alternaria solani OX=48100 GN=sol5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000014

TMHMM  Annotations     

There is no transmembrane helices in FOC1_g10008924-t38_1-p1.