CAZyme Information: FOC1_g10008842-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10008842-t38_1-p1
• CAZy Family: GT90
• CAZyme Description: UDP-glycosyltransferase 84B2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
520		57734.25	5.6626

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB730083:216446-218094(+)

Full Sequence      

MEGLKRLLLFTNSDFGQANVVLATAHELGIACEDVEIHIASFQGLRSGVDDASRSMQTTA
AQQKKKTPRPFVFHKIEGTSWGPATKRPETAIFETLELTPGVVNSAKGVAILPAVMIPWS
PREFLDMYKETERVFDEVNPDLTIVEPLFTQGLTFCHYRGARWMVLSPNTIKEFAVPVQP
KLAALWKYPTNPSSACSALPYPIPWSLIPWNIYFGFVAGYTLLTDTRLKKTTEILRDEID
PSISLMTMMELGVLRPAPPNLAILVASSPDIDYPFSIIPPQLTSCGPIIRAAPPIREVDA
GLAEWLSQGSTIYVNLGTHHKSNPTEAHQMSKAFRKVLEHADTLHSAGKPLQILWKLGRV
PDEEGNAPKRDTYTGEWALVTDELQAYIKSDRVRLTDWLVAEPKSVLGSQSIVCSVSHGG
ANSFYEALCSGIPQALLPAWTDCYDFANRVELLGIGLWANKEAKPRWQEDELAEALLEIL
FGPESAGMRKRAEEGASRHPEWEGRQMAAQEILNYLMRLG

Enzyme Prediction     

No EC number prediction in FOC1_g10008842-t38_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	7.73e-27	84	515	49	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.95e-13	202	512	124	395	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
215127	PLN02210	1.71e-11	297	494	254	427	UDP-glucosyl transferase
178170	PLN02555	1.15e-08	391	492	337	439	limonoid glucosyltransferase
278624	UDPGT	6.39e-07	394	483	325	409	UDP-glucoronosyl and UDP-glucosyl transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60995.1|GT1	0.0	1	520	1	513
CCT74337.1|GT1	0.0	1	519	1	512
QGJ00663.1|GT1	0.0	1	519	1	512
QGI69774.1|GT1	0.0	1	519	1	512
CEI70655.1|GT1	9.30e-289	5	516	5	512

PDB Hits     

FOC1_g10008842-t38_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A411KZY6|BUAB_ASPBU	2.08e-67	1	494	1	452	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1
sp|A0A1B4XBH6|SDNJ_SORAA	1.72e-59	7	497	8	476	Glycosyltransferase sdnJ OS=Sordaria araneosa OX=573841 GN=sdnJ PE=1 SV=1
sp|A0A0D1DZV5|EMT1_USTMA	4.32e-14	6	512	2	558	Erythritol-mannosyl-transferase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EMT1 PE=1 SV=1
sp|M9MH90|EMT1_PSEA3	1.26e-08	6	510	2	557	Erythritol-mannosyl-transferase 1 OS=Pseudozyma antarctica (strain T-34) OX=1151754 GN=EMT1 PE=1 SV=1
sp|Q9SKC1|U74C1_ARATH	1.25e-07	406	493	341	429	UDP-glycosyltransferase 74C1 OS=Arabidopsis thaliana OX=3702 GN=UGT74C1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOC1_g10008842-t38_1-p1.