CAZyme Information: FOC1_g10008400-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10008400-t38_1-p1
• CAZy Family: GH43
• CAZyme Description: Alpha-1,3-mannosyltransferase CMT1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
453		51084.92	5.4948

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB730167:250419-251829(-)

Full Sequence      

MYRRFIAPLLAVFCFLLVVTSLYLGRDHLTWRSGPYTPVQQEEVEKGPSLTLTTTVATTS
AKIEESPSHTPTPTATANLATTPTISNGTILSAERISHYIAAIFNSSAALPRLECPALND
NRYKVLQEPRHGDEVQDSHIDYFFALNLRNCIGILPRLIGSIVEAVRFLGPHRCALSIVE
GNSPDGTSDILSALKPFLEDLGLVYFYNSSRINPTQGNARIRKLAQLRNLALTPLYKEQV
KVTDETTVLFINDVSACTEDILELALQRRSLNADMTCAMDWTYVGPDPTFYDIWIARTIS
GDAFFEVGSDGNWNSAWNLFWNAPGTRSRYDAQQPFQVFACWNGATAFTAAPLLHGLRFR
DTRKGECFQGEPQLFCKDMWSRGFRKIAVVPSVNLEYSDEKAADIKKLKGYVSDIVQRQE
EDSTIDWVYDPPEQVRCMPTWDKQSWRPWNETL

Enzyme Prediction     

No EC number prediction in FOC1_g10008400-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT69	142	380	2.5e-70	0.9874476987447699

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403053	CAP59_mtransfer	6.89e-100	142	375	2	225	Cryptococcal mannosyltransferase 1. The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1, EC:2.4.1.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD55730.1|GT69	0.0	1	453	7	459
QGI82899.1|GT69	8.21e-289	1	453	1	452
QGI96533.1|GT69	8.21e-289	1	453	1	452
CCT69815.1|GT69	8.21e-289	1	453	1	452
QGI65652.1|GT69	8.21e-289	1	453	1	452

PDB Hits     

FOC1_g10008400-t38_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6U1Z4|CMT1_CRYNJ	7.63e-56	99	451	81	466	Alpha-1,3-mannosyltransferase CMT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.937927	0.062083

TMHMM  Annotations     

Start	End
5	24