CAZyme Information: FOC1_g10008238-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10008238-t38_1-p1
• CAZy Family: GH39
• CAZyme Description: Initiation-specific alpha-1,6-mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483		55208.30	7.8076

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB730431:380626-382342(+)

Full Sequence      

MPHRIPPEARPRTPGRSNPPPRSPHPTEELPFLEVLYSTPAEMHNNHMGCKTVMASGPRR
NIPSNLRIPPTTVEWTVTKTDSYDTKMGTPLGSPTLAASTAKFRNKVPAQMQRCIPLYMA
CVLVLFIILNFDIFYSIPSPLGVFRKEKEIVSTPSRFSTFPQKIWQTWKVDPLNFEDRDL
ITSRTWVNKNPGMRYEVLTDDNELAFVEEHFGAGSAINRPDIVRFYKSINLHIIKADLLR
YMIMYAQGGVYADIDVEALRPVHRFIPERYDERDIDLIVGVEIDQPEFSDHPILGKKSKS
FCQWTIIAKPHQPVMLHLIEHIMVWLKAEAKKQKVALGDIELTFDQVISGTGPSAFTGAL
LEQMRKNHRGGKVTWDLFHNLDESRVVGRVLVLNVEAFCAGQGHSDSGNHDSRGALVKHH
YHASNWPSKHPRYRHPAYGQVEDCNWNVECVRLWDENVAEWDKLSEEEKKLKIEQAKKPD
LGL

Enzyme Prediction     

No EC number prediction in FOC1_g10008238-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	184	267	3.9e-18	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.09e-21	159	326	81	247	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	8.13e-12	177	268	2	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
106587	cbiO	0.004	342	394	158	209	energy-coupling factor transporter ATPase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD54814.1|GT32	0.0	54	483	1	430
CCT68908.1|GT32	0.0	54	483	1	430
QGI82113.1|GT32	0.0	54	483	1	430
QGI64856.1|GT32	0.0	54	483	1	430
QGI95741.1|GT32	0.0	54	483	1	430

PDB Hits     

FOC1_g10008238-t38_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	1.22e-34	161	426	143	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	1.54e-29	160	406	130	370	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q5A4E3|OCH1_CANAL	3.00e-28	135	398	75	348	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	1.45e-19	161	340	97	300	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000024	0.000012

TMHMM  Annotations     

Start	End
114	136