CAZyme Information: FOC1_g10007412-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10007412-t38_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	KB730345|CGC2	42165.67	5.4080

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB730345:119688-120830(+)

Full Sequence      

MAPNLQTIPVPSATVQSHASNLLQLPDKTVLCTWFGGSQEGLPDISIWLSRLEPGSSSWT
TPQKVSFDENRSCQNPVLFRAPHSGEIWLLHTSQDAGNQDGAYILKRTSSDQGHTWSEAS
RLLPDVTGIFIRQPIVINGDGTWILPVFYCRTEPGHRWIGSDDISGVLYSDDNGATWKEK
QAPDSVGSVHMNIIPLVSGSSSWVAFYRSRWADNVYRSTSNNGIDWETPKATTLPNPNSG
ICAARLSSGRIAIVFNRSNASADTLKRQGLYDDITPEDDKRPNQVTKTGKDAIWGTPRKT
LTLGVSEDEGLTWRERVLEDGDGFCGTNSSSGQENRELSYPSIYIEKDGDRDVAHVAYTW
HRQHIKYVRIDDVEGWVSSN

Enzyme Prediction     

No EC number prediction in FOC1_g10007412-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	21	321	1e-25	0.8216374269005848

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227036	COG4692	1.19e-64	10	379	26	378	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
404074	BNR_2	7.74e-64	28	350	1	277	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
271234	Sialidase_non-viral	4.70e-42	9	371	6	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD48655.1|GH33	3.49e-292	1	380	1	380
QGI98506.1|GH33	2.95e-284	1	379	1	379
QGI67622.1|GH33	2.95e-284	1	379	1	379
CCT71969.1|GH33	2.95e-284	1	379	1	379
QGI84851.1|GH33	2.95e-284	1	379	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YW1_A	8.92e-08	103	261	420	577	Chain A, Neuraminidase C [Streptococcus pneumoniae TIGR4],4YW1_B Chain B, Neuraminidase C [Streptococcus pneumoniae TIGR4],4YW2_A Chain A, Neuraminidase C [Streptococcus pneumoniae TIGR4],4YW2_B Chain B, Neuraminidase C [Streptococcus pneumoniae TIGR4],4YW3_A Chain A, Neuraminidase C [Streptococcus pneumoniae TIGR4],4YW3_B Chain B, Neuraminidase C [Streptococcus pneumoniae TIGR4],4YW4_A Streptococcus pneumoniae sialidase NanC [Streptococcus pneumoniae],4YW4_B Streptococcus pneumoniae sialidase NanC [Streptococcus pneumoniae],4YW5_A Chain A, Neuraminidase C [Streptococcus pneumoniae TIGR4],4YW5_B Chain B, Neuraminidase C [Streptococcus pneumoniae TIGR4],5F9T_A Chain A, Neuraminidase C [Streptococcus pneumoniae TIGR4],5F9T_B Chain B, Neuraminidase C [Streptococcus pneumoniae TIGR4]
4YZ1_A	9.02e-08	103	261	439	596	Crystal Structure of Streptococcus pneumoniae NanC, apo structure. [Streptococcus pneumoniae TIGR4],4YZ1_B Crystal Structure of Streptococcus pneumoniae NanC, apo structure. [Streptococcus pneumoniae TIGR4],4YZ2_A Crystal Structure of Streptococcus pneumoniae NanC, in complex with 2-deoxy-2,3-didehydro-N-acetylneuraminic acid. [Streptococcus pneumoniae],4YZ2_B Crystal Structure of Streptococcus pneumoniae NanC, in complex with 2-deoxy-2,3-didehydro-N-acetylneuraminic acid. [Streptococcus pneumoniae],4YZ3_A Crystal Structure of Streptococcus pneumoniae NanC, in complex with Oseltamivir. [Streptococcus pneumoniae TIGR4],4YZ3_B Crystal Structure of Streptococcus pneumoniae NanC, in complex with Oseltamivir. [Streptococcus pneumoniae TIGR4],4YZ4_A Crystal Structure of Streptococcus pneumoniae NanC, in complex with N-Acetylneuraminic acid. [Streptococcus pneumoniae],4YZ4_B Crystal Structure of Streptococcus pneumoniae NanC, in complex with N-Acetylneuraminic acid. [Streptococcus pneumoniae],4YZ5_A Crystal Structure of Streptococcus pneumoniae NanC, in complex with 3-Sialyllactose [Streptococcus pneumoniae],4YZ5_B Crystal Structure of Streptococcus pneumoniae NanC, in complex with 3-Sialyllactose [Streptococcus pneumoniae]

Swiss-Prot Hits     

FOC1_g10007412-t38_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000080	0.000001

TMHMM  Annotations     

There is no transmembrane helices in FOC1_g10007412-t38_1-p1.