CAZyme Information: FOC1_g10007292-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10007292-t38_1-p1
• CAZy Family: GH3
• CAZyme Description: UDP-glucuronosyltransferase 1-4

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
457	KB730049|CGC4	50029.35	5.0962

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB730049:340293-341666(-)

Full Sequence      

MASHLSDVAKTATGIEQTTITGPNNTSKPHLVFGATPVDGHTYPLIRIAEDLVQRGFEVT
FIAGDQFEKAITDAGVQHVTVPPLVNPKLMAEREAIPAGIPRLLYDIRHIFTGQTPERWR
ILKGVLEGIRAEDPEREVVVMPETCFMGANPISLGGPLPKGYTKRPKVINLNPIPYMATS
IDTAPFGPGLPPDSTESGRARNQFMNQMMVGGPFADVIAHQEEVLKGLGTTEILEPQIPF
HHWMLMHDLSIQMCPPSLEYSRSDVPSNVKFSGCATPKPIPADFAYPSWWDDVKRGDRRI
VAVTQGTIARDATNLIIPTIKALSDRDDLLVVAILGQRGAFLPDDITIPFLLPHASVFVM
NAGYGGFLHGVTNGVPLVLAGETEDKPEIAMRGEWSGVAVNLKTGRPTPDTVRSGVDRIL
ADDSFKKRVDEIKAENEAMKFFDFIEEQVLSVESLET

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	170	446	2.6e-33	0.6544502617801047

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224732	YjiC	9.24e-28	28	435	1	381	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
340817	GT1_Gtf-like	4.53e-23	29	447	1	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
278624	UDPGT	1.42e-04	258	429	237	415	UDP-glucoronosyl and UDP-glucosyl transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD59501.1|GT1	0.0	1	457	1	469
QGI99903.1|GT1	0.0	1	456	1	468
CCT74071.1|GT1	0.0	1	456	1	468
QGI69014.1|GT1	0.0	1	456	1	468
QGI86382.1|GT1	0.0	1	456	1	468

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6J31_A	9.16e-08	351	449	292	394	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
6J32_A	9.23e-08	351	449	295	397	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|J4VV61|GT1_BEAB2	3.33e-119	35	450	25	455	UDP-glucosyltransferase 1 OS=Beauveria bassiana (strain ARSEF 2860) OX=655819 GN=BBA_08686 PE=2 SV=1
sp|E7CQW6|UGTA1_STABO	3.57e-78	28	454	7	436	UDP-glucosyltransferase A1 OS=Starmerella bombicola OX=75736 GN=ugtA1 PE=1 SV=1
sp|E9L011|UGTB1_STABO	8.51e-70	28	454	5	432	UDP-glucosyltransferase B1 OS=Starmerella bombicola OX=75736 GN=ugtB1 PE=1 SV=1
sp|Q8KHE4|REBG_LENAE	1.15e-55	31	446	5	418	4'-demethylrebeccamycin synthase OS=Lentzea aerocolonigenes OX=68170 GN=rebG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOC1_g10007292-t38_1-p1.