CAZyme Information: FOC1_g10007130-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10007130-t38_1-p1
• CAZy Family: GH3
• CAZyme Description: Pectate lyase H

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321	KB730325|CGC6	32920.61	3.7099

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB730325:447411-448425(-)

Full Sequence      

MTIAAGESFDGGNAIFDRGVSCTGQVEGGDSDAVFILEKGATLSNVRIGPNQIEGVHCNG
GCTLNNVVWDAVCEDAFSIKKQEDGETTTINGGGATGAEDKVIQHNGGGTVIIKDFEVSD
FGKLYRSCGNCKEMPARHVEISGGSASNGKILVGINPNMGDTAKISGIQLTNVPKECITF
EGVTDGSEPKEVGTCDSNAGSGSGSGSGDSTEAPATPTTPADGSETPAASEVADPVETSA
DGSQGDDQSGDDQSGDNDDGDKDESDDKKDDDSDDENKDEQSDNENQDQDSESENQESAD
NQQAQPSQPNFSFGSGGFGGF

Enzyme Prediction     

No EC number prediction in FOC1_g10007130-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	2	182	2.9e-70	0.9381443298969072

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	8.74e-98	1	187	17	200	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60682.1|PL3_2	1.13e-172	1	321	52	373
CCT74639.1|PL3_2	1.48e-172	1	321	46	361
QGJ00946.1|PL3_2	1.83e-172	1	321	52	367
QGI70056.1|PL3_2	1.83e-172	1	321	52	367
QGI87418.1|PL3_2	1.71e-165	1	247	52	298

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3B90_A	2.74e-25	17	191	11	205	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B90_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
3B4N_A	2.39e-24	17	191	129	323	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B4N_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_A Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
1EE6_A	3.82e-24	1	187	9	188	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	1.30e-18	1	130	14	139	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	1.33e-18	1	130	15	140	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ATC7|PLYH_EMENI	5.96e-69	6	192	57	243	Pectate lyase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyH PE=1 SV=1
sp|A1DBJ7|PLYE_NEOFI	7.91e-68	8	199	54	244	Probable pectate lyase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyE PE=3 SV=1
sp|Q5B7Z3|PLYE_EMENI	1.58e-67	8	191	54	236	Pectate lyase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyE PE=1 SV=1
sp|B8NX10|PLYE_ASPFN	3.47e-67	8	198	57	246	Probable pectate lyase E OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyE PE=3 SV=1
sp|Q2TW49|PLYE_ASPOR	3.47e-67	8	198	57	246	Probable pectate lyase E OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999856	0.000151

TMHMM  Annotations     

There is no transmembrane helices in FOC1_g10007130-t38_1-p1.