CAZyme Information: FOC1_g10006743-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10006743-t38_1-p1
• CAZy Family: GH28
• CAZyme Description: Endo-1,4-beta-xylanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
295	KB731256|CGC4	30857.87	4.5114

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB731256:436199-437181(-)

Full Sequence      

MVHFTSVFAGLSLVAGSLAAPSKEGLFSKITKRAGTPNSSGTNNGFYYSWWSDGGADATY
TNGEGGSYSMEWKDGGNVVGGKGWSPGKARTISYEGEYKPNGNSYLSVYGWTRNPLVEYY
IVESFGTYNPSSGATKKGTVEADGSTYDIFETTRTNAPSIDGTQTFQQYWSVRQQHRSTG
SVDTGLHFDAWEKAGMKLGTHDYQILATEGYFSSGSSHMTVSEGASSGGGAGGSTGGDAS
QGGDSQQGGDVQQGGDASQGGNGQQGGNGNSFQQPGSENQPQQQEIDTGANEPCQ

Enzyme Prediction     

EC	3.2.1.8:61

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	44	219	6.4e-75	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395367	Glyco_hydro_11	2.70e-107	44	217	1	174	Glycosyl hydrolases family 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAK27974.1|GH11|3.2.1.8	1.97e-180	1	295	1	295
QKD49133.1|GH11	1.76e-177	1	295	1	289
QGI85319.1|GH11	1.17e-175	1	295	1	308
CCT72437.1|GH11	1.17e-175	1	295	1	308
QGI68090.1|GH11	1.17e-175	1	295	1	308

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1YNA_A	1.17e-95	36	223	3	192	ENDO-1,4-BETA-XYLANASE, ROOM TEMPERATURE, PH 4.0 [Thermomyces lanuginosus]
5JRM_A	3.15e-93	36	223	7	194	Crystal Structure of a Xylanase at 1.56 Angstroem resolution [Fusarium oxysporum],5JRN_A Crystal Structure of a Xylanase in Complex with a Monosaccharide at 2.84 Angstroem resolution [Fusarium oxysporum f. sp. vasinfectum 25433]
1PVX_A	4.20e-91	36	223	3	192	Chain A, Protein (endo-1,4-beta-xylanase) [Paecilomyces variotii]
6Y0H_A	1.64e-90	34	222	4	193	High resolution structure of GH11 xylanase from Nectria haematococca [Fusarium vanettenii 77-13-4]
4XQD_A	1.79e-86	40	222	6	189	Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4XQD_B Chain B, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],5ZF3_A Crystal Structures of Endo-beta-1,4-xylanase II Complexed with Xylotriose [Trichoderma reesei RUT C-30],5ZH0_A Crystal Structures of Endo-beta-1,4-xylanase II [Trichoderma reesei RUT C-30],5ZO0_A Neutron structure of xylanase at pD5.4 [Trichoderma reesei RUT C-30]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q92245|XYN4_MAGGR	1.36e-102	1	221	1	229	Endo-1,4-beta-xylanase 4 OS=Magnaporthe grisea OX=148305 GN=XYL4 PE=3 SV=2
sp|G4NA54|XYN4_MAGO7	1.36e-102	1	221	1	229	Endo-1,4-beta-xylanase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=XYL4 PE=3 SV=1
sp|Q06562|XYN1_COCCA	7.39e-100	1	222	1	219	Endo-1,4-beta-xylanase I OS=Cochliobolus carbonum OX=5017 GN=XYL1 PE=1 SV=1
sp|O43097|XYNA_THELA	1.71e-99	1	223	1	223	Endo-1,4-beta-xylanase OS=Thermomyces lanuginosus OX=5541 GN=XYNA PE=1 SV=1
sp|P55333|XYNB_EMENI	9.27e-96	1	222	1	221	Endo-1,4-beta-xylanase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xlnB PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000385	0.999608	CS pos: 19-20. Pr: 0.9836

TMHMM  Annotations     

There is no transmembrane helices in FOC1_g10006743-t38_1-p1.