CAZyme Information: FOC1_g10006463-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10006463-t38_1-p1
• CAZy Family: GH20
• CAZyme Description: L-sorbosone dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427	KB730104|CGC4	45487.57	4.4678

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB730104:164291-165766(-)

Full Sequence      

MPRLVQVLLAAGATLIGLTSAQCNLTPKASIATADGVEFKLLRTGLQRPRHLVVDTEGNL
LIAEAGSKGVRRVVLDDGKDLDVCIDSDDALISNANLNHGIALTADGKTILVSTPSEVYA
YDYDASKGSVGSRRTVITGMSATSTHSTRTLTIPLAGNPNLLLVAGGSDGNLDVETVDKD
VVRSQVRVFKIDELLAADAPLEYGEAEVLGWGLRNSVGWAEDPSTGHIWSVENSVDNLYH
GDVDVHNTNPGEELNFHGLPNDTSSAQYGANYGYPGCFSIYDTSNIKDYPGGAKVGKQFA
GTPQGETDLGFTDEECQEKQAPRITFGSHLAPLDIKFLDGSAAYIAFHGSWNRNPGDGYR
LSKVDFANGEPVPESDDAKAEVPLMWNTDNTKCPSGCFRPAGLAFDKSGRLFLTSDSTGE
LYVLTGV

Enzyme Prediction     

No EC number prediction in FOC1_g10006463-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA12	25	424	5.9e-148	0.9850374064837906

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225044	YliI	4.14e-19	2	351	3	342	Glucose/arabinose dehydrogenase, beta-propeller fold [Carbohydrate transport and metabolism].
400653	SGL	2.17e-04	88	139	131	179	SMP-30/Gluconolaconase/LRE-like region. This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species. These proteins include various enzymes, such as senescence marker protein 30 (SMP-30), gluconolactonase and luciferin-regenerating enzyme (LRE). SMP-30 is known to hydrolyze diisopropyl phosphorofluoridate in the liver, and has been noted as having sequence similarity, in the region described in this family, with PON1 and LRE.
400382	GSDH	0.007	206	342	170	262	Glucose / Sorbosone dehydrogenase. Members of this family are glucose/sorbosone dehydrogenases that possess a beta-propeller fold.
225921	YvrE	0.009	51	137	123	206	Sugar lactone lactonase YvrE [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61370.1|AA12	1.23e-309	1	427	1	427
CEF78754.1|AA12	1.26e-286	1	427	1	427
CZS82044.1|AA12	1.26e-286	1	427	1	427
QPC59943.1|AA12	5.08e-282	1	427	1	429
CEI70354.1|AA12	2.93e-281	1	427	1	429

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6H7T_A	1.61e-103	19	424	1	401	Native structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6I1T_A	1.66e-103	19	424	2	402	Calcium structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6I1Q_A	4.42e-103	24	424	5	400	Iodide structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6JT5_A	2.94e-62	27	424	11	408	Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_A Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_B Chain B, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q44091|SNDH_GLULI	9.36e-16	34	426	75	443	L-sorbosone dehydrogenase OS=Gluconacetobacter liquefaciens OX=89584 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000846	0.999136	CS pos: 22-23. Pr: 0.7270

TMHMM  Annotations     

There is no transmembrane helices in FOC1_g10006463-t38_1-p1.