CAZyme Information: FOC1_g10005869-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10005869-t38_1-p1
• CAZy Family: GH162
• CAZyme Description: Putative alpha-galactosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409	KB730496|CGC1	44810.68	7.6215

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB730496:363934-365326(-)

Full Sequence      

MFFNTQSLGVVALAGLATAVPSRNHLQTREVGKLPALGWNGWNQGQCNAASEKVALATAK
TFINLGLKDAGYQYVNIDDCWSTKQRDSKGNLVPDPAKWPRGIKPVTDEIHAMGLKFGLY
GDGGAKTCAGYPGSQGHEQQDANLLASWGVDYWKYDNCYTPCNTGNGADIQTCPNNQAPS
SRPRYEKMRDLLRATGRDILYSLCNWGYDEVWTWGAQVGHMWRMSQDNWGQWADVVRIAN
QAAPILKYTVPGHYNDLDMMILANGALTPAEERTHFAIWCITKSPIILGTDMTKLNSDEV
KLITNKGLLAVNQDSLSKPAVPFTPPNTPAKGSSEIYPYWSGPISTGTVVAIVASKGNLN
TQLNLKDVPGLKDMEYSWTELLTGAKGKGKTVSANLQTHDVAVFRIDHN

Enzyme Prediction     

No EC number prediction in FOC1_g10005869-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH27	130	366	1.1e-68	0.9213973799126638

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269893	GH27	1.50e-135	35	314	1	271	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
166449	PLN02808	4.03e-90	12	358	9	331	alpha-galactosidase
177874	PLN02229	2.69e-89	35	345	63	351	alpha-galactosidase
178295	PLN02692	4.72e-87	23	357	44	354	alpha-galactosidase
374582	Melibiase_2	1.04e-75	35	314	2	284	Alpha galactosidase A.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAJ23877.1|GH27	1.40e-317	1	409	1	409
CCT72200.1|GH27	4.62e-314	1	409	1	409
QGI98724.1|GH27	5.39e-313	1	409	1	409
QGI85072.1|GH27	5.39e-313	1	409	1	409
QGI67837.1|GH27	5.39e-313	1	409	1	409

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1SZN_A	1.72e-86	32	406	9	410	Chain A, alpha-galactosidase [Trichoderma reesei],1T0O_A Chain A, alpha-galactosidase [Trichoderma reesei]
3A5V_A	5.16e-80	35	358	9	332	Crystal structure of alpha-galactosidase I from Mortierella vinacea [Umbelopsis vinacea]
1UAS_A	1.03e-79	31	409	5	362	Chain A, alpha-galactosidase [Oryza sativa]
6F4C_B	2.99e-79	31	404	5	358	Nicotiana benthamiana alpha-galactosidase [Nicotiana benthamiana]
3LRK_A	9.15e-76	11	364	11	370	Chain A, Alpha-galactosidase 1 [Saccharomyces cerevisiae],3LRL_A Chain A, Alpha-galactosidase 1 [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94221|AGALB_PENSI	9.66e-96	7	404	4	429	Probable alpha-galactosidase B OS=Penicillium simplicissimum OX=69488 GN=agl1 PE=2 SV=1
sp|A2QEJ9|AGALB_ASPNC	1.23e-95	13	404	5	437	Probable alpha-galactosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=aglB PE=3 SV=1
sp|A1C5D3|AGALB_ASPCL	2.01e-95	8	406	6	444	Probable alpha-galactosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=aglB PE=3 SV=1
sp|Q9Y865|AGALB_ASPNG	4.88e-95	13	404	5	437	Probable alpha-galactosidase B OS=Aspergillus niger OX=5061 GN=aglB PE=2 SV=1
sp|Q2UJ97|AGALB_ASPOR	7.50e-94	31	404	26	436	Probable alpha-galactosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=aglB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000260	0.999716	CS pos: 29-30. Pr: 0.7469

TMHMM  Annotations     

There is no transmembrane helices in FOC1_g10005869-t38_1-p1.