CAZyme Information: FOC1_g10005690-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10005690-t38_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
768		86269.42	5.3997

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB730516:283278-286123(-)

Full Sequence      

MHLYRIAVTFASLMSAVSALTVKSTKQWTIGTDVQGSERLNGVSYQEDALITYGDHQYVT
FYETAPAGYLNHFVKVGRRKVSPSIGDWEFLTLDDYTQKTMDGHNMISMGISGDGKIHLS
FDHHDVPINYRISKNGIAKDVPSKWTSELFGPVVHELAGSQGPYSPLTYPRFEPLSNGDL
LLEFRIGQSGSGDSYIHRYSASTGKWQAYGMYIQGDDNNAYINGIDYLDGKLYTSWTVRE
TPNADTNHGVYFAYSNDDGKTWFNTNGTKLSKPISTSDDSTLIWDVPQNSRMVNQEGQLI
DIKGRFHILMRDLLSGGHQYQHYLRKADGTWTKNAINPAGLNGPDLYDPRGKLAGDASGE
YLFGLLPDPVKQSTGIYVATASKDFKDWKSLAEIPNTSTEPLFDKTRLHESGVLSVFVRQ
AGGFPDRKLQALIQKQIENAIALRKPASALPWRPDEPCTQPLYRWSSNADEWQLLQASEP
SPNKSKATRLAVYSWNIDFMLPHGDSRMNSALKHLEELSRQHRNDNNTTVVINIQECVPS
DLTLIGEKNWIRDCFYRTDVDTANWASGAYGTTTLVDRRLDVLSCFRVHYSATQMERDAL
FVDVEASGQIVRLCNTHLESLAMEPPRRPAQMQLIASHMHAEDISGAVVTGDFNAIQPFD
RTLHTDNNLEDAYLNLGGTESDGRDDNEGYTWEQQALPELRQLFGCSRMDKVFFCGDGLE
LLGFERFGADVEPDKSEEDVRKDLLSLGFEKPWITDHLGVKAVFEIKH

Enzyme Prediction     

EC	4.2.2.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL42	40	337	3.6e-95	0.9493243243243243

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406346	BNR_4	9.35e-70	56	333	1	268	BNR repeat-containing family member. BNR_4 is a family which carries the unique sequence motif SxDxGxTW which is so characteristic of the repeats of the BNR family, pfam02012. It is unclear whether or not this unit is repeated throughout the sequences of this family, but if it is then the family is likely to be bacterial neuraminidase.
197314	TDP2	5.69e-50	490	764	1	248	Phosphodiesterase domain of human TDP2, a 5'-tyrosyl DNA phosphodiesterase, and related domains. Human TDP2, also known as TTRAP (TRAF/TNFR-associated factors, and tumor necrosis factor receptor/TNFR-associated protein), is a 5'-tyrosyl DNA phosphodiesterase. It is required for the efficient repair of topoisomerase II-induced DNA double strand breaks. The topoisomerase is covalently linked by a phosphotyrosyl bond to the 5'-terminus of the break. TDP2 cleaves the DNA 5'-phosphodiester bond and restores 5'-phosphate termini, needed for subsequent DNA ligation, and hence repair of the break. TDP2 and 3'-tyrosyl DNA phosphodiesterase (TDP1) are complementary activities; together, they allow cells to remove trapped topoisomerase from both 3'- and 5'-DNA termini. TTRAP has been reported as being involved in apoptosis, embryonic development, and transcriptional regulation, and it may inhibit the activation of nuclear factor-kB. This family belongs to the large EEP (exonuclease/endonuclease/phosphatase) superfamily that contains functionally diverse enzymes that share a common catalytic mechanism of cleaving phosphodiester bonds.
397447	Exo_endo_phos	8.38e-09	494	736	2	226	Endonuclease/Exonuclease/phosphatase family. This large family of proteins includes magnesium dependent endonucleases and a large number of phosphatases involved in intracellular signalling. This family includes: AP endonuclease proteins EC:4.2.99.18, DNase I proteins EC:3.1.21.1, Synaptojanin an inositol-1,4,5-trisphosphate phosphatase EC:3.1.3.56, Sphingomyelinase EC:3.1.4.12, and Nocturnin.
197317	EEP-1	1.25e-06	599	764	117	252	Exonuclease-Endonuclease-Phosphatase domain; uncharacterized family 1. This family of uncharacterized proteins belongs to a superfamily that includes the catalytic domain (exonuclease/endonuclease/phosphatase, EEP, domain) of a diverse set of proteins including the ExoIII family of apurinic/apyrimidinic (AP) endonucleases, inositol polyphosphate 5-phosphatases (INPP5), neutral sphingomyelinases (nSMases), deadenylases (such as the vertebrate circadian-clock regulated nocturnin), bacterial cytolethal distending toxin B (CdtB), deoxyribonuclease 1 (DNase1), the endonuclease domain of the non-LTR retrotransposon LINE-1, and related domains. These diverse enzymes share a common catalytic mechanism of cleaving phosphodiester bonds. Their substrates range from nucleic acids to phospholipids and perhaps, proteins.
197318	EEP-2	0.009	599	728	95	233	Exonuclease-Endonuclease-Phosphatase (EEP) domain superfamily; uncharacterized family 2. This family of uncharacterized proteins belongs to a superfamily that includes the catalytic domain (exonuclease/endonuclease/phosphatase, EEP, domain) of a diverse set of proteins including the ExoIII family of apurinic/apyrimidinic (AP) endonucleases, inositol polyphosphate 5-phosphatases (INPP5), neutral sphingomyelinases (nSMases), deadenylases (such as the vertebrate circadian-clock regulated nocturnin), bacterial cytolethal distending toxin B (CdtB), deoxyribonuclease 1 (DNase1), the endonuclease domain of the non-LTR retrotransposon LINE-1, and related domains. These diverse enzymes share a common catalytic mechanism of cleaving phosphodiester bonds; their substrates range from nucleic acids to phospholipids and perhaps, proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61679.1|PL42	0.0	1	768	1	809
QPC62903.1|PL42	0.0	1	766	1	782
QGI94760.1|PL42	4.51e-309	1	430	1	430
QGI63878.1|PL42	4.51e-309	1	430	1	430
QGI81148.1|PL42	4.51e-309	1	430	1	430

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7ESK_A	1.06e-302	20	430	3	413	Chain A, L-Rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum],7ESM_A Chain A, L-rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum]
7ESL_A	1.75e-301	20	430	3	413	Chain A, L-rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum]
7ESN_A	2.68e-301	20	430	5	415	Chain A, L-Rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum]
5MUM_A	3.26e-37	40	308	40	288	Glycoside Hydrolase BACINT_00347 [Bacteroides intestinalis DSM 17393]
5MVH_A	6.65e-36	40	308	35	283	Glycoside Hydrolase BACCELL_00856 [Bacteroides cellulosilyticus DSM 14838]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A109PTH9|UL24S_ALTSL	6.74e-12	102	279	150	371	Ulvan lyase, short isoform OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_107 PE=1 SV=1
sp|A0A0X9SHN5|UL24S_PSEXP	3.31e-10	102	279	150	371	Ulvan lyase, short isoform OS=Pseudoalteromonas sp. (strain PLSV) OX=1547444 GN=PLSV_3875 PE=1 SV=1
sp|A0A2Z6UD27|UL24L_GLASK	6.49e-10	102	306	136	377	Ulvan lyase, long isoform OS=Glaciecola sp. (strain KUL10) OX=2161813 GN=ullA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000236	0.999730	CS pos: 19-20. Pr: 0.9746

TMHMM  Annotations     

There is no transmembrane helices in FOC1_g10005690-t38_1-p1.