CAZyme Information: FOC1_g10005091-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10005091-t38_1-p1
• CAZy Family: GH16
• CAZyme Description: Putative FAD-linked oxidoreductase yvdP

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
725		79419.98	9.2499

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB730180:319861-322724(+)

Full Sequence      

MLRPCETAENETSRVLNNGQQLNLRAYKALDLPMEDVSMAALALAAFTSPANTSAALNNC
LASKKVPYIRPSSPQWTQEVRPYNLRLAYTPAAIALPTTVDHVQDAVKCGNQYQVRVSAK
SGGHSYGSFGYGGENGHLVIVLDSMDQVTLNKYMSCNIQAGARLGHVASELYKLGQRAIP
HGSCPGVGIAGHALHGGYGFASRTYGLTLDTFIGATVILANGSRTYAADGEGGDNQLMWA
LRGAGSSYGIVVEFDFQTIKAPDTVTPFSIELDWDENQAVEGLTAFQKFAVTAPKQLNMQ
IYIGPSGQTIQGVYYGTRAALNTALKPFLGDIKAQISASSTGGWIEGLKACANGQNLDQR
RPYNQHSTFYSTSLMTKALTRSQVKSFVRTLFDNIKDSDARHSWYILIDLFGGPNSAITT
AGSTNSAFPHRDKLLLFQFSDHGNYASHANNGFTLLKRFRESITKTMDDSDWGMYANYLD
TQLENREAVEQYYELSLGRLRELKRAYDRNDMFWNPQARKVPHWTQYQMWMDVLAAAVLL
EMSIALAIGGTEFDAESNPRTAANVLRPSKRIMNLLQRLPHGGPTPSEKGSETNSMAFAW
RIPISVISFWHGSSVGAAAPVIAVVASAGVRVVVAASLEAIDTVAVGCKKIARKGIGRNN
TFSKRALARLDFLIGHVFSASNDRESTVNLHDMQHVGLSMRGIFLARTARPSPRRRDRER
PEVYL

Enzyme Prediction     

EC	1.1.3.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	82	517	1.7e-75	0.982532751091703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	1.48e-23	91	223	1	134	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	1.17e-19	89	508	30	445	FAD/FMN-containing dehydrogenase [Energy production and conversion].
369658	BBE	1.65e-07	475	518	2	43	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD59370.1|AA7	0.0	40	517	11	504
QGI68899.1|AA7	0.0	40	517	11	488
QGI99788.1|AA7	0.0	40	517	11	488
QGI86269.1|AA7	0.0	40	517	11	488
CCT73375.1|AA7	0.0	40	517	11	488

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YJO_A	1.18e-265	47	517	25	499	Chain A, FAD-binding PCMH-type domain-containing protein [Fusarium graminearum PH-1]
6Y0R_AAA	5.78e-130	44	520	13	489	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]
5K8E_A	6.95e-123	44	518	14	491	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
3RJ8_A	2.63e-107	56	518	2	468	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]
1ZR6_A	2.12e-104	57	515	9	472	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I1S2K2|CHITO_GIBZE	2.97e-129	44	520	13	489	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1
sp|P9WEY2|DPMAF_METAN	4.92e-126	56	520	28	490	FAD-linked oxidoreductase dpmaF OS=Metarhizium anisopliae OX=5530 GN=dpmaF PE=1 SV=1
sp|E9F5F1|SUBF_METRA	3.03e-124	56	520	28	490	FAD-linked oxidoreductase subF OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=subF PE=3 SV=1
sp|G2QG48|XYLO_MYCTT	3.57e-122	44	518	14	491	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|I1SB12|MNCO_MICNN	4.78e-107	42	518	7	490	Carbohydrate oxidase OS=Microdochium nivale OX=5520 GN=MnCO PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000032	0.000013

TMHMM  Annotations     

There is no transmembrane helices in FOC1_g10005091-t38_1-p1.