CAZyme Information: FOC1_g10005032-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10005032-t38_1-p1
• CAZy Family: GH15|CBM20
• CAZyme Description: Choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
587	KB730180|CGC1	65263.36	6.2960

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB730180:148158-149932(-)

Full Sequence      

MAVKNGAYFDFIVIGGGTAGNIVAARLAENPHARILVVEAGIGTSKDNEEIRTPGLAMDI
RGSKYDWAYKTTMIKRDDYERIEKPNTRGKALGGSSSLNYFSWVPGSKGTFDMWEEYGGK
EWTWEPLVPYLRKRRSEXXXXVTYHDDAGLYAPELKNIGAGGPIPIAHAELMPEMKPFRE
LLTKAWKSTGEPVSENIFDGTMRGLVHSVNTIYKGRRSGSFLAVADKPNITIFPEVHSKR
LIIDQADRIAKGVTVITASGEELDLYATREVIVSQGVFETPKLLMLSGIGPKTELAKHSI
PLLVDSPHVGQHLLDHPGVPFVLKIKDSYSMDNHVLRKGALQDKVMSAYANGHAGPMGSP
FLEMIGFPRIDSYLEKSPEYRAAKAANDGLDPFCPYGQPHFELDFIPLFGSAFQWHFPHP
NKGSYMTVMVDLVRPVSEGGEVTLNSSDPLQQANINLNYFNNDLDIIAMREGIRFSYDVL
KNGEGFKDIVEDEYPWDMPLHDDEAMKRTVLDRSQTSFHPCGTARLAKSIEEGVVNPSLQ
VHGIKNLRVIDASVIPVIPDCRIQNSVYMVAEKGVDAIKRDHADLYH

Enzyme Prediction     

No EC number prediction in FOC1_g10005032-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	9	580	1.7e-142	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	4.04e-78	9	583	8	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.44e-74	9	579	6	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.77e-38	435	573	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.62e-18	9	570	56	568	Protein HOTHEAD
366272	GMC_oxred_N	4.10e-17	88	317	23	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD59313.1|AA3_2	0.0	1	587	1	580
QGI68848.1|AA3_2	0.0	1	586	1	579
QGI99737.1|AA3_2	0.0	1	586	1	579
CCT73322.1|AA3_2	0.0	1	586	1	579
QGI86218.1|AA3_2	0.0	1	586	1	565

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	1.09e-311	5	586	3	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	3.11e-311	5	586	3	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	8.90e-311	5	586	3	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	2.13e-66	9	581	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	8.19e-66	7	581	1	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A9AMZ9|BETA_BURM1	1.05e-53	9	579	6	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) OX=395019 GN=betA PE=3 SV=1
sp|B1Z034|BETA_BURA4	1.45e-53	9	579	6	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia ambifaria (strain MC40-6) OX=398577 GN=betA PE=3 SV=1
sp|Q39A44|BETA_BURL3	3.82e-53	9	579	6	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383) OX=482957 GN=betA PE=3 SV=1
sp|B0KN19|BETA_PSEPG	5.19e-53	9	579	5	534	Oxygen-dependent choline dehydrogenase OS=Pseudomonas putida (strain GB-1) OX=76869 GN=betA PE=3 SV=1
sp|Q88CW6|BETA_PSEPK	5.19e-53	9	579	5	534	Oxygen-dependent choline dehydrogenase OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000024	0.000024

TMHMM  Annotations     

There is no transmembrane helices in FOC1_g10005032-t38_1-p1.