CAZyme Information: FOC1_g10004976-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10004976-t38_1-p1
• CAZy Family: GH154
• CAZyme Description: Putative alpha-glucuronidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
601	KB730036|CGC2	67240.97	5.5399

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB730036:329923-331728(-)

Full Sequence      

MRPYGIRIGVSLFFDTPRGLAGLPTSDPLDPDVIKFWEEITAKLYKRVPDMLGYTIKANS
EGQPGPLTYGRTLAQGANMFARALKPHGDGVVMYRAFVYNHHLDESDLKNDRANAAVEYF
AHLDGEFEDNVIIQIKFGPIDFQVREPPSTLFAHLRKTPMICEFMVCQEYLGQQSHYVYM
APEWETILGFDMCIDDKPSLVRDIASGKVHGLNKGGYAAVTNIGDDLTWLGHHLSMSNLY
AYGRLCWDAAAPAQDILLDWIRLTFTAENQKVIDTIREIGMESWPTYEAYSGNLGIQTLC
DILYTHYGPSPGSQDGNGWGQWTRADSKALGMDRTAATGTGYAAQYPPQVAAQFERIETT
PDDLLLWFHHVPYTHKLKSGKTVIQHIYDAHYEGSANAQTFVTRWASLKGLIDDARFEHV
AFKLAYQAGHSLVWRDSVNNFYLAKCGIPDEKNRVGNYLWRIEAESMQLSGYTIVDVTPP
EAASLGRAIVASSLEKAVATTILTFPSGKRDIAVNYFDHTGGHARYELLLDGKMVREWKS
DLDTRLGHDFSEYLDGHSATRVYLRGVDVWEGAKLTVIGYPDGKDMASLDYISVLPEGVV
D

Enzyme Prediction     

EC	3.2.1.131:5	3.2.1.139:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH67	1	454	1.9e-197	0.6711509715994021

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226187	AguA2	2.09e-168	2	454	231	679	Alpha-glucuronidase [Carbohydrate transport and metabolism].
400047	Glyco_hydro_67M	5.52e-145	1	228	99	324	Glycosyl hydrolase family 67 middle domain. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the central catalytic domain of alpha-glucuronidase.
400039	Glyco_hydro_67C	5.96e-136	231	455	2	223	Glycosyl hydrolase family 67 C-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the C terminal region of alpha-glucuronidase which is mainly alpha-helical. It wraps around the catalytic domain (pfam07488), making additional interactions both with the N-terminal domain (pfam03648) of its parent monomer and also forming the majority of the dimer-surface with the equivalent C-terminal domain of the other monomer of the dimer.
271143	CBM6-CBM35-CBM36_like	1.12e-05	461	594	1	124	Carbohydrate Binding Module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules. This alignment model also contains the C-terminal domains of bacterial insecticidal toxins, where they may be involved in determining insect specificity through carbohydrate binding functionality.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62251.1|GH67	0.0	1	601	234	834
QGI99538.1|GH67	0.0	1	601	234	834
QGI68648.1|GH67	0.0	1	601	234	834
CCT73043.1|GH67	0.0	1	601	234	834
QGI85840.1|GH67	0.0	1	601	234	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1MQP_A	1.73e-140	2	454	226	675	The Crystal Structure Of Alpha-D-Glucuronidase From Bacillus Stearothermophilus T-6 [Geobacillus stearothermophilus]
1MQR_A	4.86e-140	2	454	226	675	Chain A, ALPHA-D-GLUCURONIDASE [Geobacillus stearothermophilus]
1K9D_A	9.68e-140	2	454	226	675	The 1.7 A crystal structure of alpha-D-glucuronidase, a family-67 glycoside hydrolase from Bacillus stearothermophilus T-1 [Geobacillus stearothermophilus],1L8N_A The 1.5A crystal structure of alpha-D-glucuronidase from Bacillus stearothermophilus T-1, complexed with 4-O-methyl-glucuronic acid and xylotriose [Geobacillus stearothermophilus],1MQQ_A THE CRYSTAL STRUCTURE OF ALPHA-D-GLUCURONIDASE FROM BACILLUS STEAROTHERMOPHILUS T-1 COMPLEXED WITH GLUCURONIC ACID [Geobacillus stearothermophilus]
1K9E_A	9.68e-140	2	454	226	675	Chain A, alpha-D-glucuronidase [Geobacillus stearothermophilus],1K9F_A Chain A, alpha-D-glucuronidase [Geobacillus stearothermophilus]
1GQI_A	1.14e-95	2	453	229	674	Structure of Pseudomonas cellulosa alpha-D-glucuronidase [Cellvibrio japonicus],1GQI_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase [Cellvibrio japonicus],1GQJ_A Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with xylobiose [Cellvibrio japonicus],1GQJ_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with xylobiose [Cellvibrio japonicus],1GQK_A Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid [Cellvibrio japonicus],1GQK_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid [Cellvibrio japonicus],1GQL_A Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid and xylotriose [Cellvibrio japonicus],1GQL_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid and xylotriose [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CC12|AGUA_ASPCL	2.48e-269	2	601	242	840	Probable alpha-glucuronidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=aguA PE=3 SV=1
sp|B8NGU1|AGUA_ASPFN	6.31e-262	2	601	241	839	Probable alpha-glucuronidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=aguA PE=3 SV=1
sp|B0Y2K1|AGUA_ASPFC	6.52e-262	2	601	242	840	Probable alpha-glucuronidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=aguA PE=3 SV=1
sp|Q4WW45|AGUA_ASPFU	6.52e-262	2	601	242	840	Probable alpha-glucuronidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=aguA PE=3 SV=1
sp|A1DD80|AGUA_NEOFI	1.06e-260	2	601	242	840	Probable alpha-glucuronidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=aguA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.948436	0.051592

TMHMM  Annotations     

There is no transmembrane helices in FOC1_g10004976-t38_1-p1.