CAZyme Information: FOC1_g10004949-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10004949-t38_1-p1
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256		28831.01	8.5820

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB730036:238830-239600(-)

Full Sequence      

MLLQPLISWSRRMCIASQCPSPIRVISTIGNEVDQASAICYSTQATPPNVVLRLMPLGGS
VTYGVGSSDGNGYRKFLQDLLLAHGYEVCMVGSRKAGSMHNNENEGWRGYRLDQIESKAR
RSVATVKPNLFTINAGSNDCIQNYQLDVFRERMDNLIKYLWKTSPLSTVILSTLLVNVDE
QFNSRVLDINSYLRELVVLKEAERKRIVLADMYSTKGPDLDDLMDGTHPNDDGYNKMAHI
WFNAIQKARANGFFKK

Enzyme Prediction     

No EC number prediction in FOC1_g10004949-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	52	245	2.6e-56	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	1.46e-38	52	245	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	5.47e-19	57	234	2	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	2.85e-17	57	244	4	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
395531	Lipase_GDSL	1.12e-13	54	241	1	224	GDSL-like Lipase/Acylhydrolase.
238872	SGNH_hydrolase_like_2	1.58e-10	57	241	7	188	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI68641.1|CE3	1.74e-143	4	254	4	254
QKD62224.1|CE3	7.70e-139	55	256	1	202
QYT04935.1|CE3	1.64e-79	24	253	22	253
BCS23966.1|CE3	3.53e-79	41	252	53	266
QPG99528.1|CE3	5.70e-78	5	253	3	247

PDB Hits     

FOC1_g10004949-t38_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RLB8|CESA_RUMFL	2.00e-15	23	246	15	261	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999935	0.000103

TMHMM  Annotations     

There is no transmembrane helices in FOC1_g10004949-t38_1-p1.