CAZyme Information: FOC1_g10004416-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10004416-t38_1-p1
• CAZy Family: GH114
• CAZyme Description: Sterol 3-beta-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
752		80889.42	8.1157

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB730531:201070-203961(-)

Full Sequence      

MSKSRSQSPSKGKESHETDNVLDIPWDAPPPYELHSSGSVLASTSRVNDHGGVDIEFSSL
QPDEVNRLLPPDKAQEIEPTSSLLSAAPSGPFPALNVVIQVVGSRDLGDVQPFIALGVAL
QRYGHRVRLATHDTFTDFVRSSGLEFYPVGGDPEDLMAYMVKNPGLIPSMESLRGGDIGR
KRVMIHDMLRGFWSSCFKPDLVSNRPFVADAIIANPPSFAHVHCAQALGIPLHMMFTMPW
TATRSFPHPLANIQSQNMDPRASNYLSYGVVDLMTWQGLGDVINAWRVSDLHLDPLAAAV
GPDIVGLMKVPYTYCWSPALVPKPSDWGESIDICGFFMRDEPSYTPPQDLADFLARGLPP
VYIGTDSVFYLGDCPHEWLFKRVAAVVHHGGAGTTACGLVNGRPTTIVPFFGDQPFWGSV
VASNGAGPPPIAYKSISVEKLSSAIKFCLSPEAQAAANRIASQMRQERGVETAVNSFHRH
LPIANLTCELIPHNAARWQYVGKSKKGDKGQIRISNAALKVLLDAKKAKLSDFEPLRPKE
YLVENERWDPLTAGASSVLGTMTDFTSALGGAFIDPFKDVKRVRPDGTRRSAGTATAVAS
GKALQGMTTAVVKGSLVDVPLALAEGLRNTPRLYGEKSGGTVAAKNFGVGFYEGVTDIVT
KPMKGAKEEGALGFFKGVGKGSLNMVAKPGSAMFGLLAYPAQGVYKSVKSMKANKARELV
AAGRVESLSDGQAGSMQPDAGQVVRRFQELTA

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	117	479	9.7e-40	0.981675392670157

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	5.92e-60	95	480	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.67e-27	99	479	4	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	1.52e-21	97	247	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	9.53e-05	108	473	7	382	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
227376	MRS6	7.63e-04	628	709	2335	2414	Vacuolar protein sorting-associated protein [Intracellular trafficking and secretion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60288.1|GT1	0.0	1	752	1	803
QGI70427.1|GT1	0.0	1	750	1	806
QGI87785.1|GT1	0.0	1	750	1	806
QGJ01316.1|GT1	0.0	1	750	1	806
CCT75037.1|GT1	0.0	1	750	1	801

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	7.91e-59	99	484	24	442	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	1.24e-58	99	484	44	462	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	2.82e-18	95	467	1	385	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	8.17e-18	95	467	1	368	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	6.45e-13	95	464	1	383	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	2.86e-119	46	482	109	575	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	6.09e-113	92	484	190	613	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q54IL5|UGT52_DICDI	4.72e-63	67	496	1137	1624	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1
sp|A7ERM5|ATG26_SCLS1	7.52e-63	78	502	926	1387	Sterol 3-beta-glucosyltransferase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) OX=665079 GN=atg26 PE=3 SV=1
sp|Q6C8M8|ATG26_YARLI	1.16e-60	99	484	999	1416	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000001

TMHMM  Annotations     

There is no transmembrane helices in FOC1_g10004416-t38_1-p1.