CAZyme Information: FOC1_g10004390-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10004390-t38_1-p1
• CAZy Family: GH11
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase yteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358		40879.29	4.2007

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB730531:144675-145850(-)

Full Sequence      

MADTMIAKGVKPDLGYQDAVLYLGFEKAYELSGDQKYLDWYIGQIDGPVVQEDGSIKGLN
TSRYILDEYRMGHNYLYLYNQTGEPKYETAANTVRRMLDSYPRTPSGGFWHQQFFRDQMW
LDGIFMADSFYARWTHLYDSDNDTAWDDILLQYELIHENTINETTGLHVHGWVEGEASWA
DPETGRAPNVWGRALGWYFMALVEVLQYFPTSHSGYDQLLRYLESVAKGLKASRDPDLGS
WWQVMNEPYPKREGNFIESSGSSMFTWGLLKAVDLGYLDSDEYLETAKDAFTSSIDNFVT
EGEDGSLILNSTVAECGLTSSNVTFEYYVSRPKLENGQNGVGPFMLASYEWESWAKDA

Enzyme Prediction     

No EC number prediction in FOC1_g10004390-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	11	352	2e-94	0.9668674698795181

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	1.61e-66	1	352	19	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	1.68e-66	4	352	17	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60262.1|GH105	3.24e-270	1	358	29	386
CCT75065.1|GH105	1.52e-262	1	358	32	389
QGI70454.1|GH105	1.57e-260	1	358	32	391
QGI87812.1|GH105	1.57e-260	1	358	32	391
QGJ01344.1|GH105	1.57e-260	1	358	32	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	3.15e-79	1	353	8	360	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.50e-51	16	358	41	371	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	6.42e-51	16	358	31	361	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]
5NOA_A	1.73e-09	16	350	56	370	Polysaccharide Lyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	9.14e-08	16	291	39	304	Chain A, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	7.74e-51	16	358	41	371	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	2.08e-21	166	350	38	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	2.08e-21	166	350	38	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
sp|P9WF04|UH105_ALTSL	4.04e-07	19	295	95	369	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOC1_g10004390-t38_1-p1.