CAZyme Information: FOC1_g10004365-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10004365-t38_1-p1
• CAZy Family: GH109
• CAZyme Description: Unsaturated glucuronyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
537	KB730531|CGC1	59482.03	6.3218

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB730531:78978-80591(-)

Full Sequence      

MVPLLQDTPIATNSVLTISSKPGDMARSDSSASSATEDERVALSETSWSEGAADTKEGDI
HAQKHALHKVLSELFEENILAKPCRAASRDLQGFIPAHDGFPEIVPQQGPRQGHWEFREP
EFWTCGFFPGTLYALLERSIRYPGSLRADNPENRSSTIIRNHLLPLCKSWSEPLHAMASR
TDTHDIGFIIMPALRRDWELFGTERSLASIVQAAHSLATRYVPAAGAIRSWDCLLKKDIT
VTDMENNLLVIIDSMCNLDLLFYAAAQTGEQRLADIAASHATTLLKTHLRPESVRSTAKH
GYQGQLYSTCHVANVDPQTGDLKWRRTAQGYADHSTWSRGQAWAILGYAQTYNWTKDERF
LDAACGCAEYFLYRLETSPSCVELPIETGRGHANPRRGRHVPLWDFDAPIENPQDPLRDS
SAGVIAANGMLLLSQSLAALGRHTMSRRFFDASIEIVKDTLDVCLATEKAKLTTSGNNGT
SIKVEDVVLGATFDALLKYGTANNNENARRRYANHGLVYGDYYLVEFGNLLLSMGLV

Enzyme Prediction     

No EC number prediction in FOC1_g10004365-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	118	526	1.8e-85	0.9726443768996961

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271200	LanM-like	2.64e-04	261	376	501	629	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60239.1|GH88	0.0	1	537	1	537
QGJ01387.1|GH88	1.07e-317	1	536	1	531
QGI70497.1|GH88	1.07e-317	1	536	1	531
QGI87852.1|GH88	1.07e-317	1	536	1	531
CCT75108.1|GH88	3.22e-316	1	536	1	531

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	4.52e-33	102	434	52	320	Crystal structure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	9.91e-26	99	391	44	299	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	1.00e-25	99	391	45	300	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3ANI_A	4.56e-25	99	391	45	300	Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]
3VXD_A	4.56e-25	99	391	45	300	Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_B Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_C Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_D Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KLZ3|PLH1_FORAG	2.48e-33	123	526	77	389	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
sp|Q9A0T3|UCDH_STRP1	9.93e-29	99	454	46	337	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
sp|Q8DR77|UCDH_STRR6	3.26e-28	99	430	43	313	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
sp|Q8E372|UCDH_STRA3	5.16e-25	99	391	45	300	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
sp|Q9RC92|UGL_BACGL	2.72e-23	123	453	42	310	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000037	0.000001

TMHMM  Annotations     

There is no transmembrane helices in FOC1_g10004365-t38_1-p1.