CAZyme Information: FOC1_g10003441-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10003441-t38_1-p1
• CAZy Family: CE16
• CAZyme Description: 6-hydroxy-D-nicotine oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
581		63459.13	8.8028

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB730470:184298-186236(+)

Full Sequence      

MTRLYNFIVFLLPTVLAGSVPKTCKAYPGSSDWPSHKAWSRLNDTLDGRLFAPVPPGAVC
HKGWPSYDKDACPRVAEAWKHYDLHTQNPVSLIYDQYSNWTCLPDKSYPCSGSGYPAYVV
NVTKAEDIKIGIDFARKNNIRLVVKNTGHDYMGRSIAPGSLSLWTHHLKDITYHKGSFKL
YNSKTVITGDTVTAGAGTQMYDLYTTLDKYGRVVVGGGGKTVGLGGYVTGGGHSLLSTKH
GLAVDQVLQMTMVTPSGKILTINEDNHSDLFWAIRGGGGSTFGVLTSITMKVYKSPKITA
SAFTIGTSAAAPFKYDLLAYIISQFPSLSDAGLSGYTILSPQTPNPAGGPDEVAGIQGVF
AAQDVNDPEYILKLFKPINDTIQKRWPGAVQFSATKEEYGSFLEWYDVYFDQGAAGVTLY
LASRLLGREALGDEKKFRGTLEESLVSAGGLTVHLIAGKGVRDAKPRGGSAAVNPGWRKS
YIHAISGESFEPFNKTSKAEAVKTLNTSMEPFRKLSPDTGAYINEALPFEPDWQHAFWGK
NYEKLLAIKKSVDPDDVFWCFPCVGSEKWAQKDNGRLCRVK

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	114	306	4.1e-52	0.3951965065502183

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	3.15e-14	112	558	28	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	3.94e-12	116	263	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
369658	BBE	6.90e-12	521	559	1	39	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
215242	PLN02441	5.35e-05	239	286	186	232	cytokinin dehydrogenase
273751	FAD_lactone_ox	0.002	96	305	3	191	sugar 1,4-lactone oxidases. This model represents a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesizing ascorbic acid or a derivative. These include L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by Prosite motif PS00862; OX2_COVAL_FAD; 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57322.1|GH43_11	2.88e-83	14	579	491	1065
QKD57322.1|CBM91|GH43_11	2.88e-83	14	579	491	1065
UJO23499.1|AA7	1.47e-19	116	558	63	477
UNI23960.1|AA7	5.66e-18	116	296	48	218
UQC87672.1|AA7	3.51e-16	116	319	70	256

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F72_A	2.27e-88	23	580	27	574	Crystal structure of VAO-type flavoprotein MtVAO615 at pH 7.5 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_A Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_B Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6F74_A	1.88e-78	17	579	24	597	Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_B Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_C Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_D Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6FYE_A	1.85e-19	116	294	45	210	The crystal structure of EncM H138T mutant [Streptomyces maritimus],6FYE_B The crystal structure of EncM H138T mutant [Streptomyces maritimus]
6FYD_A	4.39e-19	116	294	45	210	The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_B The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_C The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_D The crystal structure of EncM T139V mutant [Streptomyces maritimus]
6FYG_A	1.04e-18	116	294	45	210	The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_B The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_C The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_D The crystal structure of EncM V135T mutant [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A0E0RTV6|ZEB1_GIBZE	1.47e-90	24	579	27	562	FAD-linked oxidoreductase ZEB1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ZEB1 PE=2 SV=2
sp|D4AS41|A7056_ARTBC	5.62e-89	10	580	13	588	Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07056 PE=1 SV=2
sp|A0A1V6PBT1|CALF_PENDC	7.95e-89	23	580	26	575	Bifunctional decalin synthase calF OS=Penicillium decumbens OX=69771 GN=calF PE=1 SV=1
sp|S0DL65|APF9_GIBF5	2.02e-88	9	580	6	585	FAD-linked oxidoreductase apf9 OS=Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) OX=1279085 GN=apf9 PE=1 SV=1
sp|G2QDQ9|VAO15_MYCTT	1.17e-87	23	580	27	574	VAO-type flavoprotein oxidase VAO615 OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=MYCTH_2305637 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000229	0.999762	CS pos: 26-27. Pr: 0.7350

TMHMM  Annotations     

There is no transmembrane helices in FOC1_g10003441-t38_1-p1.