CAZyme Information: FOC1_g10003189-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10003189-t38_1-p1
• CAZy Family: CBM67|GH78
• CAZyme Description: Reticuline oxidase-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
517		56875.62	8.6640

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB730011:107481-109308(-)

Full Sequence      

MPSVEKDPNANGKPSDDEAVIDKAKKEYNKLRSRFNLGRIIPNVILPALVGAAVWARQPS
DNHFTAPPVALRKCLDSWASPFNLGRIVLPAAVVRPSTDEQVSGFVRCVADSNVKVQARS
GGHSYALGAGGYKVSLSVHLINYRYVTLNKTVWLTTIGGGSLLGDIDDLLDNQKGNRAFP
HGVCPGVGIGGHATIGGLGPSSRMWGATLDHVVEAKVVTANGTIVTASEAKYPDLFFAIR
GAAAGFGIVTQFVIKTVEKPKKTLHFTHRTPYTNSEGIVEQFKRWKEMVADKKLDHRIGT
EFTLDPEGSKITATWFGTRQDFDQSGIAERLGLKLTPVESSWVNTKRWQYENAVLTLSDI
PTEFFSRSLGFTADDATSFNATERLVQLIAANKSQSKLKWFCIFDATGGKVAEPAMDSTA
YAHRDKVMFYQSYLYNIWAPLTAEEKGLLNGIHETIVGGIPTRSPSTYPGYIDPLLENPQ
EAYWGPNLDRLEAIKREWDPEDVFHNPQSVRPAKLKL

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	89	510	7.5e-70	0.9694323144104804

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	8.03e-21	90	228	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	6.19e-20	59	513	7	459	FAD/FMN-containing dehydrogenase [Energy production and conversion].
369658	BBE	9.08e-12	467	511	1	45	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
215242	PLN02441	4.47e-09	37	262	16	244	cytokinin dehydrogenase
178402	PLN02805	5.63e-04	89	264	133	312	D-lactate dehydrogenase [cytochrome]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UNI23960.1|AA7	6.15e-122	77	514	35	473
QUC19098.1|AA7	4.18e-116	77	513	35	471
CCA70426.1|AA7	1.67e-113	81	513	84	518
QRD00400.1|AA7	2.42e-112	81	514	37	476
AHG26149.1|AA7	2.87e-107	81	516	33	473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K8E_A	3.65e-65	45	515	3	497	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
6Y0R_AAA	2.21e-56	76	512	44	490	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]
6YJO_A	6.54e-55	68	513	32	504	Chain A, FAD-binding PCMH-type domain-containing protein [Fusarium graminearum PH-1]
3RJ8_A	1.09e-54	81	514	28	473	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]
1ZR6_A	2.04e-54	76	512	29	478	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B6HNK6|SORD_PENRW	1.24e-72	80	512	35	469	FAD-linked oxidoreductase sorD OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=sorD PE=3 SV=1
sp|G2QG48|XYLO_MYCTT	1.88e-64	45	515	3	497	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|I1S2K2|CHITO_GIBZE	1.14e-55	76	512	44	490	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1
sp|I1SB12|MNCO_MICNN	8.91e-54	81	514	50	495	Carbohydrate oxidase OS=Microdochium nivale OX=5520 GN=MnCO PE=1 SV=2
sp|Q6PW77|GOOX_SARSR	9.67e-54	76	512	48	497	Glucooligosaccharide oxidase OS=Sarocladium strictum OX=5046 GN=gluO PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999953	0.000059

TMHMM  Annotations     

There is no transmembrane helices in FOC1_g10003189-t38_1-p1.