CAZyme Information: FOC1_g10002886-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10002886-t38_1-p1
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
885		98204.09	5.3098

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB730079:181123-183799(+)

Full Sequence      

MASETTITIVHVSFDHHHSGIGVATSRPSISWRFGGTTVGWTQESCDIEVCLRQQASYPA
ADAIQIFTLDTTDSVNVPWPARELSSGEQATVRVRSQGQGIETTWSEPFRVEAGLLKATD
WTCDLIETPFLVETTETHPPTLFRRSFVLKQVPCKVRLYITSHGIHEAEINGIKVSDQVL
APGWTAYDHELQYQVHDVGQLLRQGTENVIGIHVAEGWYCGRLGFGGGRHNIWGSRLGVI
AQLVLTFQEEITQTIGSDSDWTCHRSPIETASLYDGETYDMAKEQVGWSSAGFNDEGWSA
VKVCGYDPERLTCSDGPPIRPTQSLLAIQITHSINGNAILDFGQNLVGWVQFRVPKGPAG
HKITLVHAETLENGECVTRTLRHAKATDVVVLGQSSSPEEVYWNPRFTFHGFRYVEVIDW
PEAELQVDDFSAVVIHSDMQRTGYLTCSDPLISRLHENVVWSMRGNFVGIPTDCPQRDER
LGYTGDIQIFSPTACFLYDCYSTLRSWLRNLAAEQKEGANGSPPIFSPKAMPVPNFPLAI
WGDATILVPWDLYWAYGDVEILSTQYDTMICWIDQGIPRAANGLWGQVRVQLGDWLDPMA
PPDRPYLGITDSQLVANAYLIRITDVMSEVCTILGHASKASAYSKHAVELRAAFASEYIT
QTGRLVSDSQTAYALAIQFDLFHILHRFRCKIATGFAGTPAIGHALSKTGKDQLFYMMLT
NTKPPSWLYPVTMGATTIWERWDSVLPDGTIHPSEMTSLNHYALGAVADWLHAYVGGLKP
LLPGWKKFRIAPKPGGGITWASARFECPYGKIVVDWKLDDGNLVVEVNVPHNTTAEVQLG
TKECEVVGSGFHTFRAAYVEPEKLSLPPPLPFTTEDDDPKLVTKD

Enzyme Prediction     

EC	3.2.1.40:1	3.2.1.40:8	3.1.1.73:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	330	839	4.5e-166	0.998015873015873
CBM67	137	305	3.8e-34	0.8863636363636364

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	3.01e-127	441	775	2	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
400715	Bac_rhamnosid_N	1.68e-65	155	323	5	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
336149	Bac_rhamnosid	2.62e-31	336	436	6	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	6.35e-24	777	851	1	77	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD52036.1|GH78	0.0	1	885	1	900
QKD48510.1|GH78	8.66e-306	9	878	6	882
UPK93442.1|GH78	5.65e-303	9	878	3	878
UKZ72242.1|GH78	1.19e-279	7	858	4	894
ADI05275.1|GH78	5.72e-277	14	855	8	859

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GSZ_A	1.02e-259	7	860	2	869	Crystal structure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3W5M_A	5.10e-143	155	837	318	992	Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	9.98e-103	21	839	44	898	Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q82PP4|RHA78_STRAW	1.94e-142	155	837	318	992	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
sp|T2KNB2|PLH20_FORAG	5.18e-134	21	845	48	884	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
sp|P9WF03|RHA78_ALTSL	4.59e-127	21	836	44	875	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
sp|T2KPL4|PLH28_FORAG	9.46e-74	4	855	27	922	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000006

TMHMM  Annotations     

There is no transmembrane helices in FOC1_g10002886-t38_1-p1.