CAZyme Information: FOC1_g10002159-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10002159-t38_1-p1
• CAZy Family: PL3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
494	KB730368|CGC1	55869.76	6.4505

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB730368:39637-41121(+)

Full Sequence      

MISRNRSGRRRSAALAFIVITVLVLNYGGLLSLPFSFEEPPQPDRPDFDLAPPCAPTLDH
LRRSSYGLTRDIIYQKRCIRPVVDKKLDSQIVSQNPDALIKSGQTVQLDQACEGWTESTC
EPVTLRVPPPYPQQDYSGFLFGVATSLDRLNESMSQFESWLGNTHAQLLAVITDAGDESK
YKQVTEQFRQRGIELSIKDPWNKAITSNEQHFAIVRDLLAHVTPKTQWTAIVDDDTFFPS
LYPMSKILGKYDHKLPAYVGGLSENYDAVKHHGYMAFGGAGIFLSPALLRELDPHLEECL
KVDHVPQGDGLLKQCIYSKTKTKLTVVKGLHQLDMGGDMSGFYESGRLPMSLHHWKSWHQ
APVDKMVRISEFCGSCFLQRFAFGADTVLTNGYSIVQYSAGLESVDLNKMEGSWEGAEGF
DWSLSPMRSKMDRRLKKSYHLVDTEVVGKNIRQIYIHRLEDDIPGPDEKSKDPKKMPPKI
EEMKDEVIELLWEL

Enzyme Prediction     

No EC number prediction in FOC1_g10002159-t38_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	9.05e-12	224	354	209	341	hypothetical protein; Provisional
398362	DUF604	2.15e-07	271	354	4	90	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.
367085	Fringe	3.63e-06	224	358	83	231	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT63554.1|GT31	0.0	1	494	1	494
QGI77030.1|GT31	0.0	1	494	1	494
QGI90742.1|GT31	0.0	1	494	1	494
QGI59829.1|GT31	0.0	1	494	1	494
QKD52171.1|GT31	0.0	1	490	1	490

PDB Hits     

FOC1_g10002159-t38_1-p1 has no PDB hit.

Swiss-Prot Hits     

FOC1_g10002159-t38_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.987880	0.012138

TMHMM  Annotations     

Start	End
13	35